Rbbp9 (RB binding protein 9, serine hydrolase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rbbp9 (RB binding protein 9, serine hydrolase) Rattus norvegicus

Analyze

Symbol:

Rbbp9

Name:

RB binding protein 9, serine hydrolase

RGD ID:

3542

Description:

Predicted to enable hydrolase activity. Involved in regulation of cell population proliferation. Predicted to be located in nucleoplasm. Orthologous to human RBBP9 (RB binding protein 9, serine hydrolase); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

B5T overexpressed gene protein; B5T-overexpressed gene protein; MGC124617; putative hydrolase RBBP9; RBBP-9; retinoblastoma binding protein 9; retinoblastoma-binding protein 9; serine hydrolase RBBP9

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	131,925,095 - 131,939,042 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	131,925,341 - 131,932,156 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	135,854,833 - 135,861,526 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	144,438,915 - 144,445,608 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	142,142,123 - 142,148,816 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	138,701,579 - 138,708,332 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	138,701,586 - 138,708,332 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	145,131,493 - 145,138,246 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	133,091,157 - 133,097,910 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	132,996,734 - 133,003,483 (-)	NCBI
Celera	3	130,819,354 - 130,826,133 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital dyserythropoietic anemia type II (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4,4'-diaminodiphenylmethane (ISO)

acrylamide (EXP)

Aroclor 1254 (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dioxygen (ISO)

disodium selenite (ISO)

endosulfan (EXP)

Enterolactone (ISO)

epoxiconazole (ISO)

fenvalerate (EXP)

finasteride (EXP)

gentamycin (EXP)

ivermectin (ISO)

methapyrilene (EXP)

methylparaben (ISO)

N-nitrosodiethylamine (EXP)

nickel sulfate (ISO)

nicotine (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

pyrogallol (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

torcetrapib (ISO)

trimellitic anhydride (ISO)

urethane (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of gene expression (ISO)

regulation of cell population proliferation (IMP)

response to nematode (ISO)

type II pneumocyte differentiation (ISO)

Cellular Component

nucleoplasm (IEA,ISO)

Molecular Function

hydrolase activity (IEA)

protein binding (IPI,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	A retinoblastoma-binding protein that affects cell-cycle control and confers transforming ability.	Woitach JT, etal., Nat Genet 1998 Aug;19(4):371-4.

Additional References at PubMed

PMID:12477932	PMID:23376485

Genomics

Comparative Map Data

Rbbp9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	131,925,095 - 131,939,042 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	131,925,341 - 131,932,156 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	135,854,833 - 135,861,526 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	144,438,915 - 144,445,608 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	142,142,123 - 142,148,816 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	138,701,579 - 138,708,332 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	138,701,586 - 138,708,332 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	145,131,493 - 145,138,246 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	133,091,157 - 133,097,910 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	132,996,734 - 133,003,483 (-)	NCBI
Celera	3	130,819,354 - 130,826,133 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

RBBP9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	18,486,540 - 18,497,225 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	20	18,486,540 - 18,497,225 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	18,467,184 - 18,477,869 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	18,415,184 - 18,425,887 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	18,415,189 - 18,425,887	NCBI
Celera	20	18,541,234 - 18,551,942 (-)	NCBI		Celera
Cytogenetic Map	20	p11.23	NCBI
HuRef	20	18,429,215 - 18,439,909 (-)	NCBI		HuRef
CHM1_1	20	18,467,190 - 18,477,891 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	18,537,660 - 18,548,351 (-)	NCBI		T2T-CHM13v2.0

Rbbp9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	144,384,185 - 144,392,779 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	144,384,185 - 144,392,789 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	144,542,265 - 144,550,859 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	144,542,265 - 144,550,869 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	144,368,001 - 144,376,595 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	144,233,706 - 144,242,300 (-)	NCBI		MGSCv36	mm8
MGSCv36	2	145,595,875 - 145,604,246 (-)	NCBI		MGSCv36	mm8
Celera	2	145,728,377 - 145,736,792 (-)	NCBI		Celera
Cytogenetic Map	2	G1	NCBI

Rbbp9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	27,033,658 - 27,044,558 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	27,037,875 - 27,044,558 (-)	NCBI	ChiLan1.0	ChiLan1.0

RBBP9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	20	18,422,645 - 18,430,170 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	18,422,652 - 18,430,170 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	20	18,451,015 - 18,459,231 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

RBBP9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	4,704,957 - 4,712,644 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	4,704,362 - 4,710,798 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	4,635,528 - 4,643,633 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	5,112,474 - 5,120,576 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	5,112,440 - 5,120,570 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	4,712,327 - 4,720,421 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	4,816,933 - 4,825,030 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	5,095,537 - 5,103,633 (+)	NCBI		UU_Cfam_GSD_1.0

Rbbp9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	153,355,664 - 153,366,992 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	1,787,028 - 1,798,277 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936485	1,787,048 - 1,796,233 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBBP9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	26,736,526 - 26,760,242 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	26,740,559 - 26,749,698 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	30,230,145 - 30,239,276 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RBBP9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	47,549,090 - 47,559,459 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	47,552,024 - 47,559,365 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666078	2,282,476 - 2,292,825 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rbbp9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	19,214,536 - 19,222,530 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	19,214,436 - 19,222,511 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rbbp9
38 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	292
Count of miRNA genes:	188
Interacting mature miRNAs:	215
Transcripts:	ENSRNOT00000010678
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum insulin level (CMO:0000358)	3	115638168	135181505	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	3	115638168	135181505	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat

Markers in Region

BF386174

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	131,930,904 - 131,931,056 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	138,707,123 - 138,707,274	NCBI	Rnor6.0
Rnor_5.0	3	145,137,037 - 145,137,188	UniSTS	Rnor5.0
RGSC_v3.4	3	133,096,701 - 133,096,852	UniSTS	RGSC3.4
Celera	3	130,824,924 - 130,825,075	UniSTS
RH 3.4 Map	3	1181.2	UniSTS
Cytogenetic Map	3	q41	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	28	53	37	19	37	1	1	74	35	38	11	1
Low		15	4	4		4	7	10			3		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF025819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC101915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000010678 ⟹ ENSRNOP00000010678

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	131,925,341 - 131,932,156 (-)	Ensembl
Rnor_6.0 Ensembl	3	138,701,586 - 138,708,332 (-)	Ensembl

RefSeq Acc Id:

NM_019219 ⟹ NP_062092

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	131,925,361 - 131,932,114 (-)	NCBI
Rnor_6.0	3	138,701,579 - 138,708,332 (-)	NCBI
Rnor_5.0	3	145,131,493 - 145,138,246 (-)	NCBI
RGSC_v3.4	3	133,091,157 - 133,097,910 (-)	RGD
Celera	3	130,819,354 - 130,826,133 (-)	RGD

Sequence:

show sequence

GTCTCACGTCTGCATTAATGGCGTCCCCTACCAAGGCAGTGATTGTTCCTGGGAACGGAGGCGG
GGATGTGGCCACCCACGGCTGGTACGGCTGGGTGAGAAAGGGGCTGGAGCAGATTCCTGGTTTC
CAGTGTTTGGCTAAAAACATGCCTGACCCAATTACCGCTCGAGAGAGCATCTGGCTGCCCTTCA
TGGAGACAGAACTGCACTGTGATGAGAAGACCATCATCATAGGCCACAGTTCCGGGGCCATCGC
AGCCATGAGGTATGCAGAGACACATCAGGTATACGCTCTCATATTGGTGTCTGCATACACATCA
GACTTGGGAGATGAAAATGAGCGTGCAAGTGGGTACTTCAGCCGCCCCTGGCAGTGGGAGAAGA
TCAAGGCCAACTGCCCTCACATTATACAGTTTGGCTCTACTGATGACCCCTTCCTTCCATGGAA
GGAACAACAAGAAGTGGCAGATAGGCTGGACGCCAAACTGTACAAATTCACTGACCGTGGTCAC
TTTCAGAACACAGAGTTCCATGAACTGATTAGAGTGGTGAAGTCTATGCTGACTCCTGCTCTGT
AACACGCCAGGATGGGGTAGAAGAGTAACAGCCGCTACCCTCACACAGCTTAGACATGGACGTC
CGTCCAGTTAGACTACAGAAGTGTCTGAGCAACAAACCCATTTGAACACTCACACTGAGTTAGT
AGCACTTCCAGTTCCCACAGAGCTTAAATCTCCCCAAAAGCTACTAGCTACAGCAGTATGTTTC
CTGTTTGATAAGAGACAGGTTTTTTATTTTTAAGCTATCCTGTTGATGCAAAGAGAGTTAAGTC
AGAAGAATCCAGAACTTGACATAGACCTGGTTGTGTGTCCCTGTAATCATTTCAGAAAGCAGGG
TCAGGAGGGAAGGCTATCTTGACCCTGTCTCAGAAAGAGTGAGCAAGAAGATGACCCAGGTCTC
CTGAGGCTCATTCCAAATTATAACTCACTATGTTTAGCAAGATGTGTTCCACTTCTGAGACCCC
AGTACTTGGAAAACTGAGGAAGGTTCATCTTGAGTTTGAGACCTTGTCTAGGCTAAGTAAACCC
TGTCTCAAAACAACAACAAAAACAGGTTTTCATTCAACTTATATGACTGACACTTTCCATTTGT
AATAAAAAATTTTCTCTTACTGGGGAAATGAAAACACGATTCAAGGTCCAGAATGTTGTCTTAG
AACTCAAAACTCTGGTTGCTCTTTAAAACTGGCTCAAGAGAATAAACTCAAACTTGGGTGTTCA
TCATTGAAATTCCTGACCCCACCACGTCCCCAACCGTCCAGACTCTACAGTGAGAGTGACACAT
ATGATGCTAGTAGACTGCAGGCAGTATCTGTTATACACTGTATAGACTGCAGATTCGATCATGG
GAGTGCTGCAATATAGAAATGTGACCTATGTCTTTTTTACTAGAGAATATAGTGTGTATATAAT
TCCTACATGAATTATGGTAACTGGGAACAGCATTGTAATTAAAAGATTTGCAAATGCTACTACA
AGACAAAGACCAGGTCATCCCTTTGTGAACTTGGTCGTAAACATTTTTAGAATCTCTATGAAGT
CCAAGAAAAACAAGATAACTAAAATGACATAATACTAAAGGGTGGAAAACAAGGAGCAATCGTA
TTTTGTTATTAAGTTTTTAAGTATCTTCAAAAGAACTTTTCCAGGGCTAGGGAGAAGGCTGACA
GTCAAGAGGCTACTGAGTTTTTTTCCAGAGTTCTGAGTTCAATTCCCAGCAACTACATGGTAGT
CACAACCATCTGTAATGGACCCGATGCCCTCTTCTGGTGTGTCTGAAGACAGCTACAGTGTACT
CACATACATAAAATAAGTAAATCTTAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104444 ⟹ XP_038960372

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	131,925,095 - 131,939,042 (-)	NCBI

RefSeq Acc Id:

XM_039104445 ⟹ XP_038960373

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	131,925,095 - 131,932,146 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_062092	(Get FASTA)	NCBI Sequence Viewer
	XP_038960372	(Get FASTA)	NCBI Sequence Viewer
	XP_038960373	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC40205	(Get FASTA)	NCBI Sequence Viewer
	AAI01916	(Get FASTA)	NCBI Sequence Viewer
	EDL95156	(Get FASTA)	NCBI Sequence Viewer
	EDL95157	(Get FASTA)	NCBI Sequence Viewer
	O88350	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_062092 ⟸ NM_019219
- UniProtKB:	Q3T1H7 (UniProtKB/Swiss-Prot), O88350 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MASPTKAVIVPGNGGGDVATHGWYGWVRKGLEQIPGFQCLAKNMPDPITARESIWLPFMETELH CDEKTIIIGHSSGAIAAMRYAETHQVYALILVSAYTSDLGDENERASGYFSRPWQWEKIKANCP HIIQFGSTDDPFLPWKEQQEVADRLDAKLYKFTDRGHFQNTEFHELIRVVKSMLTPAL hide sequence

RefSeq Acc Id:

ENSRNOP00000010678 ⟸ ENSRNOT00000010678

RefSeq Acc Id:	XP_038960372 ⟸ XM_039104444
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960373 ⟸ XM_039104445
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88350-F1-model_v2	AlphaFold	O88350	1-186	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692484

Promoter ID:

EPDNEW_R3009

Type:

initiation region

Name:

Rbbp9_1

Description:

RB binding protein 9, serine hydrolase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	138,708,356 - 138,708,416	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3542	AgrOrtholog
BioCyc Gene	G2FUF-47597	BioCyc
Ensembl Genes	ENSRNOG00000007972	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000010678	ENTREZGENE
	ENSRNOP00000010678.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010678	ENTREZGENE
	ENSRNOT00000010678.5	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7935765	IMAGE-MGC_LOAD
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Hydrolase_RBBP9/YdeN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29459	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124617	IMAGE-MGC_LOAD
NCBI Gene	29459	ENTREZGENE
PANTHER	SERINE HYDROLASE RBBP9	UniProtKB/Swiss-Prot
	SERINE HYDROLASE RBBP9	UniProtKB/Swiss-Prot
	SERINE HYDROLASE RBBP9	UniProtKB/TrEMBL
	SERINE HYDROLASE RBBP9	UniProtKB/TrEMBL
Pfam	Ser_hydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rbbp9	PhenoGen
Superfamily-SCOP	SSF53474	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q4I8_RAT	UniProtKB/TrEMBL
	O88350	ENTREZGENE
	Q3T1H7	ENTREZGENE
	RBBP9_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q3T1H7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-03	Rbbp9	RB binding protein 9, serine hydrolase	Rbbp9	retinoblastoma binding protein 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Rbbp9	retinoblastoma binding protein 9		retinoblastoma-binding protein 9	Name updated	1299863	APPROVED
2002-06-10	Rbbp9	retinoblastoma-binding protein 9			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_mutations_overexpression	overexpression confers resistance to TGF-beta1 mediated growth inhibition in liver epithelial cells	69955
gene_physical_interaction	binds retinoblastoma (Rb), can displace E2F from E2F-1 complexed with Rb in vitro	69955

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar