Advanced Search (OLGA)

Gene: Psme1 (proteasome activator subunit 1) Rattus norvegicus

Analyze

Symbol:

Psme1

Name:

proteasome activator subunit 1

RGD ID:

3429

Description:

Predicted to enable endopeptidase activator activity. Predicted to be involved in regulation of G1/S transition of mitotic cell cycle and regulation of proteasomal protein catabolic process. Predicted to act upstream of or within antigen processing and presentation of exogenous antigen. Predicted to be part of proteasome activator complex. Predicted to be active in cytoplasm and nucleoplasm. Orthologous to human PSME1 (proteasome activator subunit 1); PARTICIPATES IN antigen processing and presentation pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

11S regulator complex subunit alpha; activator of multicatalytic protease subunit 1; PA28a; PA28alpha; protease (prosome, macropain) 28 subunit, alpha; proteasome (prosome, macropain) 28 subunit, alpha; proteasome (prosome, macropain) activator subunit 1; proteasome activator 28 subunit alpha; proteasome activator complex subunit 1; REG-alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Psme1-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,038,962 - 33,041,849 (+)	NCBI		GRCr8
mRatBN7.2	15	29,069,012 - 29,071,888 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,068,729 - 29,071,890 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	30,914,716 - 30,917,592 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,061,922 - 32,064,798 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,304,268 - 30,307,144 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,256,071 - 34,258,947 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,256,071 - 34,258,947 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,146,266 - 38,149,142 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,712,892 - 33,715,769 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,728,591 - 33,731,469 (+)	NCBI
Celera	15	28,644,934 - 28,647,810 (+)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

Brain-Lung-Thyroid Syndrome (ISO)

carcinoma (ISO)

esophagus squamous cell carcinoma (ISO)

Experimental Mammary Neoplasms (ISO)

human immunodeficiency virus infectious disease (ISO)

lysinuric protein intolerance (ISO)

Specific Granule Deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,6-dimethoxyphenol (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP)

actinomycin D (ISO)

alendronic acid (EXP)

all-trans-retinoic acid (ISO)

alpha-hexachlorocyclohexane (EXP)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

bleomycin A2 (EXP)

bromobenzene (EXP)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP,ISO)

dehydroepiandrosterone (EXP)

diazinon (EXP)

dibutyl phthalate (EXP,ISO)

dicyclanil (ISO)

diuron (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

ethanol (EXP)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

furfural (ISO)

gentamycin (EXP)

glyphosate (ISO)

heparin (EXP)

hydrogen peroxide (ISO)

inulin (ISO)

ivermectin (ISO)

lithium chloride (ISO)

Mesaconitine (EXP)

methidathion (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

microcystin RR (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosomorpholine (EXP)

Nutlin-3 (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

PhIP (EXP)

pirinixic acid (ISO)

propiconazole (EXP)

raloxifene (EXP)

selenium atom (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sulfadimethoxine (EXP)

testosterone (ISO)

tetrachloromethane (EXP)

thiram (ISO)

titanium dioxide (ISO)

toluene (EXP)

triadimefon (EXP)

Tributyltin oxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antigen processing and presentation of exogenous antigen (ISO)

regulation of G1/S transition of mitotic cell cycle (IBA)

regulation of proteasomal protein catabolic process (IBA)

Cellular Component

cytoplasm (IBA)

nucleoplasm (IBA)

proteasome activator complex (IEA)

proteasome complex (IEA)

Molecular Function

endopeptidase activator activity (IBA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

antigen processing and presentation pathway (IEA)

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Primary structures of two homologous subunits of PA28, a gamma-interferon-inducible protein activator of the 20S proteasome.	Ahn JY, etal., FEBS Lett 1995 Jun 5;366(1):37-42.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9679960	PMID:12477932	PMID:15944286	PMID:19182904	PMID:20458337	PMID:21098724	PMID:23376485	PMID:36715894

Genomics

Comparative Map Data

Psme1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,038,962 - 33,041,849 (+)	NCBI		GRCr8
mRatBN7.2	15	29,069,012 - 29,071,888 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,068,729 - 29,071,890 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	30,914,716 - 30,917,592 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,061,922 - 32,064,798 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	30,304,268 - 30,307,144 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	34,256,071 - 34,258,947 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,256,071 - 34,258,947 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,146,266 - 38,149,142 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,712,892 - 33,715,769 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,728,591 - 33,731,469 (+)	NCBI
Celera	15	28,644,934 - 28,647,810 (+)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

PSME1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,136,194 - 24,138,962 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,136,163 - 24,138,967 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	24,605,403 - 24,608,171 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	23,675,218 - 23,678,016 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	23,675,217 - 23,678,015	NCBI
Celera	14	4,469,848 - 4,472,646 (+)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	4,720,599 - 4,723,242 (+)	NCBI		HuRef
CHM1_1	14	24,604,038 - 24,606,847 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,334,505 - 18,337,273 (+)	NCBI		T2T-CHM13v2.0

Psme1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	55,815,951 - 55,818,984 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	55,815,580 - 55,818,986 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	55,578,494 - 55,581,527 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	55,578,123 - 55,581,529 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	56,197,331 - 56,200,364 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	54,532,565 - 54,535,598 (+)	NCBI		MGSCv36	mm8
Celera	14	53,383,350 - 53,386,383 (+)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

Psme1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	36,262,114 - 36,264,994 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	36,262,114 - 36,264,996 (-)	NCBI	ChiLan1.0	ChiLan1.0

PSME1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	25,490,494 - 25,493,326 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	24,706,986 - 24,709,818 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	4,912,390 - 4,915,219 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	23,036,223 - 23,039,405 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	23,033,548 - 23,039,405 (+)	Ensembl	panpan1.1		panPan2

PSME1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,131,197 - 4,134,001 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,131,345 - 4,134,006 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,052,885 - 4,055,693 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,241,777 - 4,244,585 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,241,348 - 4,244,585 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	3,932,403 - 3,935,211 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	3,994,149 - 3,996,957 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,256,309 - 4,259,117 (+)	NCBI		UU_Cfam_GSD_1.0

Psme1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	35,980,669 - 35,983,504 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	403,112 - 408,473 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936722	405,491 - 408,277 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSME1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	75,160,766 - 75,164,810 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	75,161,830 - 75,164,531 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	80,433,126 - 80,435,826 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	7	q12-q23	NCBI

PSME1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,122,086 - 1,124,907 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	1,122,631 - 1,125,416 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666036	12,803,781 - 12,806,636 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psme1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	8,397,344 - 8,400,285 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624820	8,397,344 - 8,400,273 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Psme1
9 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	25
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000025887
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	20248600	37896129	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat

Markers in Region

Psme1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,070,638 - 29,071,171 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,257,698 - 34,258,230	NCBI	Rnor6.0
Rnor_5.0	15	38,147,893 - 38,148,425	UniSTS	Rnor5.0
RGSC_v3.4	15	33,714,520 - 33,715,052	UniSTS	RGSC3.4
Celera	15	28,646,561 - 28,647,093	UniSTS
Cytogenetic Map	15	p13	UniSTS

AW413925

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,071,740 - 29,071,873 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,258,800 - 34,258,932	NCBI	Rnor6.0
Rnor_5.0	15	38,148,995 - 38,149,127	UniSTS	Rnor5.0
RGSC_v3.4	15	33,715,622 - 33,715,754	UniSTS	RGSC3.4
Celera	15	28,647,663 - 28,647,795	UniSTS
Cytogenetic Map	15	p13	UniSTS

UniSTS:237187

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,071,885 - 29,072,091 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,258,945 - 34,259,150	NCBI	Rnor6.0
Rnor_5.0	15	38,149,140 - 38,149,345	UniSTS	Rnor5.0
RGSC_v3.4	15	33,715,767 - 33,715,972	UniSTS	RGSC3.4
Celera	15	28,647,808 - 28,648,013	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D45249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219304	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233635	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025887 ⟹ ENSRNOP00000025887

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,068,729 - 29,071,890 (+)	Ensembl
Rnor_6.0 Ensembl	15	34,256,071 - 34,258,947 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098373 ⟹ ENSRNOP00000086094

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,069,034 - 29,071,890 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101716 ⟹ ENSRNOP00000080362

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,068,729 - 29,071,890 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111999 ⟹ ENSRNOP00000096823

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,069,065 - 29,071,872 (+)	Ensembl

RefSeq Acc Id:

NM_017264 ⟹ NP_058960

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,038,971 - 33,041,847 (+)	NCBI
mRatBN7.2	15	29,069,012 - 29,071,888 (+)	NCBI
Rnor_6.0	15	34,256,071 - 34,258,947 (+)	NCBI
Rnor_5.0	15	38,146,266 - 38,149,142 (+)	NCBI
RGSC_v3.4	15	33,712,892 - 33,715,769 (+)	RGD
Celera	15	28,644,934 - 28,647,810 (+)	RGD

Sequence:

show sequence

ACTCCCCAAACCCAGGAAGGCGGTGCAGGTTTCGAGCTGTGCTTTCGCTTTCCCTTCCCGCTGC
CCACCCCAGGCTCCGCGTGCGGCGTTCAGCCCCCGGCTCTGGCCATGGCTACACTGAGGGTCCA
TCCTGAAGCCCAAGCCAAGGTGGATGTGTTTCGTGAGGACCTGTGTAGTAAGACAGAGAACCTG
CTTGGGAGCTATTTTCCCAAGAAGATCTCAGAGTTGGATGCCTTCTTAAAGGAGCCAGCTCTCA
ACGAAGCCAACCTGAGCAATCTGAAGGCTCCATTGGACATCCCAGTCCCTGATCCCGTCAAGGA
GAAAGAGAAGGAGGAGCGGAAGAAGCAACAGGAGAAGGAAGAGAAGGACGAAAAGAAGAAAGGG
GACGAAGACGACAAAGGTCCTCCCTGTGGTCCAGTGAACTGCAATGAGAAGATTGTGGTCCTCC
TGCAACGCCTAAAGCCCGAGATCAAGGATGTCATTGAGCAACTCAACCTGGTTACTACCTGGTT
GCAGCTACAGATACCTCGGATAGAGGATGGGAATAATTTTGGCGTGGCTGTCCAGGAAAAGGTG
TTTGAGCTGATGACCAGCCTTCATACCAAGCTGGAAGGCTTCCAAACGCAGATCTCTAAGTACT
TCTCCGAGAGGGGTGATGCCGTGGCCAAAGCAGCCAAGCAGCCTCATGTGGGTGATTATCGGCA
GCTGGTGCATGAGCTGGACGAGGCGGAATACCAGGAGATCCGGCTGATGGTCATGGAGATCCGT
AACGCTTATGCTGTGTTATATGACATCATCCTGAAGAACTTTGAGAAGCTCAAGAAGCCCCGTG
GAGAGACAAAGGGGATGATCTATTGAGCCCCCTCTCTCGTTCTATGATGGGTATAACAGAAACC
TTCCTACTCTTGACTAGGAACTCTAGACTGCACCCAGTCTTCTTCCTGCTGGGGTCTCCTCCCT
CACTCTGCCTTCCAAACACAATAAATACATAGTTGCCCACAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_063274189 ⟹ XP_063130259

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,038,962 - 33,041,849 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_058960	(Get FASTA)	NCBI Sequence Viewer
	XP_063130259	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60574	(Get FASTA)	NCBI Sequence Viewer
	BAA08206	(Get FASTA)	NCBI Sequence Viewer
	EDM14241	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025887.3
	ENSRNOP00000080362.1
	ENSRNOP00000086094.1
	ENSRNOP00000096823
	ENSRNOP00000096823.1
GenBank Protein	Q63797	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058960 ⟸ NM_017264

- UniProtKB:

Q63797 (UniProtKB/Swiss-Prot), Q6P9V7 (UniProtKB/TrEMBL), F7F0J8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATLRVHPEAQAKVDVFREDLCSKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIP
VPDPVKEKEKEERKKQQEKEEKDEKKKGDEDDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQL
NLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFQTQISKYFSERGDAVAKAAKQP
HVGDYRQLVHELDEAEYQEIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

hide sequence

Ensembl Acc Id:

ENSRNOP00000025887 ⟸ ENSRNOT00000025887

Ensembl Acc Id:

ENSRNOP00000080362 ⟸ ENSRNOT00000101716

Ensembl Acc Id:

ENSRNOP00000086094 ⟸ ENSRNOT00000098373

Ensembl Acc Id:

ENSRNOP00000096823 ⟸ ENSRNOT00000111999

RefSeq Acc Id:	XP_063130259 ⟸ XM_063274189
- Peptide Label:	isoform X1
- UniProtKB:	Q63797 (UniProtKB/Swiss-Prot)

Protein Domains

Proteasome activator PA28 C-terminal Proteasome activator PA28 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63797-F1-model_v2	AlphaFold	Q63797	1-249	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699672

Promoter ID:

EPDNEW_R10195

Type:

initiation region

Name:

Psme1_1

Description:

proteasome activator subunit 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	34,256,122 - 34,256,182	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3429	AgrOrtholog
BioCyc Gene	G2FUF-13712	BioCyc
Ensembl Genes	ENSRNOG00000019041	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025887.6	UniProtKB/TrEMBL
	ENSRNOT00000098373.1	UniProtKB/TrEMBL
	ENSRNOT00000101716.1	UniProtKB/TrEMBL
	ENSRNOT00000111999	ENTREZGENE
	ENSRNOT00000111999.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.120.180	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.20.5.120	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6890794	IMAGE-MGC_LOAD
InterPro	PA28_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PA28_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PA28_N_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_activ_PA28	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_activ_PA28_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Proteasome_activ_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29630	UniProtKB/TrEMBL
MGC_CLONE	MGC:72874	IMAGE-MGC_LOAD
NCBI Gene	29630	ENTREZGENE
PANTHER	PROTEASOME ACTIVATOR COMPLEX SUBUNIT 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10660	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PA28_alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PA28_beta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Psme1	PhenoGen
RatGTEx	ENSRNOG00000019041	RatGTEx
Superfamily-SCOP	SSF47216	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZQ53_RAT	UniProtKB/TrEMBL
	A0A8I6A5D1_RAT	UniProtKB/TrEMBL
	A0A8I6AU10_RAT	UniProtKB/TrEMBL
	F7F0J8	ENTREZGENE, UniProtKB/TrEMBL
	PSME1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6P9V7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-11	Psme1	proteasome activator subunit 1	Psme1	proteasome (prosome, macropain) activator subunit 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Psme1	proteasome (prosome, macropain) activator subunit 1	Psme1	proteasome (prosome, macropain) 28 subunit, alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Psme1	proteasome (prosome, macropain) 28 subunit, alpha		protease (prosome, macropain) 28 subunit, alpha	Name updated	1299863	APPROVED
2002-06-10	Psme1	protease (prosome, macropain) 28 subunit, alpha			Name updated	70584	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)