Pccb (propionyl-CoA carboxylase subunit beta)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Pccb (propionyl-CoA carboxylase subunit beta) Rattus norvegicus

Analyze

Symbol:

Pccb

Name:

propionyl-CoA carboxylase subunit beta

RGD ID:

3265

Description:

Predicted to enable propionyl-CoA carboxylase activity. Predicted to be involved in amino acid catabolic process and fatty acid catabolic process. Predicted to be located in mitochondrial matrix. Predicted to be part of catalytic complex. Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in amino acid metabolic disorder and propionic acidemia. Orthologous to human PCCB (propionyl-CoA carboxylase subunit beta); PARTICIPATES IN 3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway; 3-hydroxyisobutyric aciduria pathway; 3-methylcrotonyl CoA carboxylase 1 deficiency pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC93516; PCCase subunit beta; propanoyl-CoA:carbon dioxide ligase subunit beta; propionyl CoA carboxylase, beta polypeptide; propionyl Coenzyme A carboxylase, beta polypeptide; propionyl-CoA carboxylase beta chain, mitochondrial; propionyl-CoA carboxylase beta subunit

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	101,591,218 - 101,641,213 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	101,590,737 - 101,641,234 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	107,253,215 - 107,303,289 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	105,452,530 - 105,502,604 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	103,295,053 - 103,345,127 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	109,368,887 - 109,418,871 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	109,368,624 - 109,418,872 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	108,785,668 - 108,836,131 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	105,946,482 - 105,996,472 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	105,965,673 - 106,015,928 (-)	NCBI
Celera	8	100,982,344 - 101,032,252 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amino acid metabolic disorder (ISO)

Developmental Disabilities (ISO)

genetic disease (ISO)

Primary Lymphedema with Myelodysplasia (ISO)

propionic acidemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amiodarone (EXP)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (EXP,ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chlormequat chloride (EXP)

chlorpyrifos (ISO)

cisplatin (EXP)

clofibrate (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP)

diethylstilbestrol (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flutamide (EXP)

folpet (ISO)

gentamycin (EXP)

glyphosate (ISO)

hydralazine (ISO)

hydrogen cyanide (ISO)

indometacin (EXP)

isobutanol (ISO)

isotretinoin (ISO)

L-ethionine (EXP)

methimazole (EXP)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

omeprazole (EXP)

ozone (ISO)

paclitaxel (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (EXP)

poly(propylene imine) macromolecule (ISO)

potassium cyanide (ISO)

resveratrol (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (ISO)

sulfadimethoxine (EXP)

temozolomide (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

triptonide (ISO)

tungsten (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amino acid catabolic process (TAS)

fatty acid catabolic process (TAS)

Cellular Component

catalytic complex (ISO)

mitochondrial matrix (ISO,ISS)

mitochondrion (IBA)

Molecular Function

ATP binding (IEA)

ligase activity (IEA)

propionyl-CoA carboxylase activity (IBA,ISO,ISS,TAS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway (ISO)

3-hydroxyisobutyric aciduria pathway (ISO)

3-methylcrotonyl CoA carboxylase 1 deficiency pathway (ISO)

3-methylglutaconic aciduria type 1 pathway (ISO)

3-methylglutaconic aciduria type 3 pathway (ISO)

glyoxylate and dicarboxylate metabolic pathway (IEA)

isobutyryl-CoA dehydrogenase deficiency pathway (ISO)

isovaleric acidemia pathway (ISO)

malonic aciduria pathway (ISO)

maple syrup urine disease pathway (ISO)

methylmalonate semialdehyde dehydrogenase deficiency pathway (ISO)

methylmalonic acidemia pathway (ISO)

methylmalonic aciduria, cobalamin-related pathway (ISO)

propanoate metabolic pathway (IEA,ISO)

propionic acidemia pathway (ISO)

valine, leucine and isoleucine degradation pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
4.	Coding sequence of the precursor of the beta subunit of rat propionyl-CoA carboxylase.	Kraus JP, etal., Proc Natl Acad Sci U S A 1986 Nov;83(21):8049-53.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.	Three independent mutations in the same exon of the PCCB gene: differences between Caucasian and Japanese propionic acidaemia.	Tahara T, etal., J Inherit Metab Dis. 1993;16(2):353-60.

Additional References at PubMed

PMID:6765947	PMID:13752080	PMID:14651853	PMID:16023992	PMID:18614015

Genomics

Comparative Map Data

Pccb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	101,591,218 - 101,641,213 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	101,590,737 - 101,641,234 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	107,253,215 - 107,303,289 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	105,452,530 - 105,502,604 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	103,295,053 - 103,345,127 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	109,368,887 - 109,418,871 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	109,368,624 - 109,418,872 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	108,785,668 - 108,836,131 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	105,946,482 - 105,996,472 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	105,965,673 - 106,015,928 (-)	NCBI
Celera	8	100,982,344 - 101,032,252 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

PCCB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	136,250,340 - 136,330,169 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	136,250,340 - 136,337,896 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	135,969,182 - 136,049,011 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	137,451,857 - 137,531,701 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	137,451,845 - 137,531,703	NCBI
Celera	3	134,394,227 - 134,474,215 (+)	NCBI		Celera
Cytogenetic Map	3	q22.3	NCBI
HuRef	3	133,346,299 - 133,425,999 (+)	NCBI		HuRef
CHM1_1	3	135,932,709 - 136,012,564 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	138,996,153 - 139,070,827 (+)	NCBI		T2T-CHM13v2.0

Pccb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	100,864,085 - 100,916,993 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	100,864,085 - 100,916,951 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	100,982,032 - 101,034,940 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	100,982,032 - 101,034,898 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	100,882,457 - 100,935,294 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	100,791,390 - 100,844,227 (-)	NCBI		MGSCv36	mm8
Celera	9	100,520,833 - 100,575,235 (-)	NCBI		Celera
Cytogenetic Map	9	E4	NCBI
cM Map	9	53.09	NCBI

Pccb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955501	2,474,330 - 2,563,837 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955501	2,474,330 - 2,563,107 (-)	NCBI	ChiLan1.0	ChiLan1.0

PCCB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	3	134,186,097 - 134,264,246 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	133,304,472 - 133,382,664 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	140,768,319 - 140,845,972 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	140,768,319 - 140,849,270 (+)	Ensembl	panpan1.1		panPan2

PCCB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	32,689,732 - 32,782,204 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	32,687,839 - 32,836,366 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	32,674,600 - 32,767,066 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	33,218,542 - 33,311,304 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	33,218,274 - 33,331,089 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	32,901,613 - 32,994,062 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	32,968,904 - 33,061,334 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	33,212,801 - 33,305,014 (+)	NCBI		UU_Cfam_GSD_1.0

Pccb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	72,346,028 - 72,405,814 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936529	9,106,496 - 9,176,394 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936529	9,106,525 - 9,166,311 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PCCB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	77,217,428 - 77,316,568 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	77,217,481 - 77,314,779 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	84,587,489 - 84,684,642 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PCCB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	54,110,014 - 54,198,405 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	54,108,389 - 54,198,329 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	27,159,277 - 27,253,677 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pccb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	12,661,777 - 12,810,991 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	12,662,419 - 12,811,112 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pccb
473 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	31
Count of miRNA genes:	29
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000021657
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	93535351	123900184	Rat
1358893	Bp263	Blood pressure QTL 263	5.01		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
1358903	Bp252	Blood pressure QTL 252	7	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
738014	Anxrr15	Anxiety related response QTL 15	3.6	0.005	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	95718998	123900184	Rat
2300182	Bmd56	Bone mineral density QTL 56	5.4		femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	95718998	123900184	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	100149864	120994388	Rat

Markers in Region

RH131981

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	101,591,284 - 101,591,487 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	109,368,954 - 109,369,156	NCBI	Rnor6.0
Rnor_5.0	8	108,786,214 - 108,786,416	UniSTS	Rnor5.0
RGSC_v3.4	8	105,946,549 - 105,946,751	UniSTS	RGSC3.4
Celera	8	100,982,411 - 100,982,613	UniSTS
RH 3.4 Map	8	1174.9	UniSTS
Cytogenetic Map	8	q31	UniSTS

RH134649

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	101,590,950 - 101,591,159 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	109,368,620 - 109,368,828	NCBI	Rnor6.0
Rnor_5.0	8	108,785,880 - 108,786,088	UniSTS	Rnor5.0
RGSC_v3.4	8	105,946,215 - 105,946,423	UniSTS	RGSC3.4
Celera	8	100,982,077 - 100,982,285	UniSTS
RH 3.4 Map	8	1172.9	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	36	11	8
Low											5
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M14634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021657 ⟹ ENSRNOP00000021657

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	101,590,737 - 101,641,234 (-)	Ensembl
Rnor_6.0 Ensembl	8	109,368,624 - 109,418,872 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096615 ⟹ ENSRNOP00000089837

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	101,590,737 - 101,641,234 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000111922 ⟹ ENSRNOP00000088818

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	101,590,737 - 101,641,234 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113920 ⟹ ENSRNOP00000084320

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	101,590,737 - 101,641,226 (-)	Ensembl

RefSeq Acc Id:

NM_017030 ⟹ NP_058726

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	101,591,218 - 101,641,213 (-)	NCBI
Rnor_6.0	8	109,368,887 - 109,418,871 (-)	NCBI
Rnor_5.0	8	108,785,668 - 108,836,131 (-)	NCBI
RGSC_v3.4	8	105,946,482 - 105,996,472 (-)	RGD
Celera	8	100,982,344 - 101,032,252 (-)	RGD

Sequence:

show sequence

AAAAAATGGCGGCGGCGATTCGGATTCGGGCGATGGCAGCTGGAACGAGGCTCAGAGTTCTGAA
CTGCGGCCTCCGCACCACAATCCGCAGCCTTTGCAGCCAGCCGGTCTCAGTTAACGAGCGCATC
GAAAACAAGCGCCATGCCGCGCTGCTGGGAGGAGGCCAGCGACGCATCGACGCACAGCACAAGC
GAGGAAAGCTGACAGCCAGGGAGCGGATCAGTCTCCTGCTGGATCCTGGCAGCTTCGTGGAGAG
TGACATGTTTGTGGAACACAGGTGTGCCGACTTCGGAATGGCTGCCGAGAAGAATAAGTTTCCT
GGAGATAGTGTGGTCACTGGACGGGGCAGAATCAATGGACGATTGGTTTATGTCTTCAGTCAGG
ATTTTACAGTTTTTGGAGGCAGTCTGTCAGGCGCACATGCTCAGAAGATCTGCAAAATCATGGA
CCAGGCCATAACAGTGGGGGCTCCAGTGATCGGACTCAATGACTCCGGGGGCGCCAGAATCCAG
GAGGGGGTGGAGTCCTTGGCTGGCTATGCAGACATCTTCCTGAGGAATGTCACAGCGTCCGGAG
TCATCCCTCAGATTTCTCTGATCATGGGCCCATGCGCTGGTGGGGCCGTCTACTCCCCCGCCCT
GACAGACTTCACATTCATGGTGAAGGACACGTCCTACCTGTTTATCACTGGCCCTGAAGTTGTG
AAGTCTGTTACCAATGAAGACGTGACTCAGGAGCAGCTGGGTGGTGCCAAGACCCACACCACTG
TGTCAGGTGTGGCCCACAGAGCTTTCGACAATGACGTCGATGCTCTGTGTAACCTGCGTGAATT
CTTCAACTTTCTGCCCCTCAGCAACCAGGACCCGGCTCCCATCCGAGAGTGCCATGACCCCAGT
GACCGTCTGGTTCCTGAGCTGGATACAGTTGTCCCTTTGGAGTCAAGCAAAGCCTATAACATGC
TAGACATCATACATGCAGTGATTGACGAGAGAGAGTTTTTTGAGATAATGCCCAATTATGCAAA
AAACATTGTCATTGGCTTTGCAAGAATGAATGGGAGGACCGTTGGAATTGTTGGCAACCAGCCC
AACGTGGCTTCAGGGTGCCTGGACATTAATTCATCTGTGAAGGGGGCTCGCTTTGTCAGATTCT
GTGATGCTTTCAGCATTCCTCTCATCACTTTCGTTGATGTCCCTGGCTTCCTGCCTGGCACAGC
GCAGGAATATGGAGGCATCATCCGGCATGGTGCCAAGCTGCTCTACGCCTTTGCCGAGGCCACC
GTGCCCAAAATCACGGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCCA
AACACCTTCTTGGTGATACCAACTATGCCTGGCCCACAGCTGAGATTGCAGTCATGGGTGCAAA
GGGTGCCGTGGAGATCATCTTCAAAGGACACCAAGACGTGGAAGCCGCCCAGGCAGAGTATGTG
GAAAAGTTTGCCAATCCTTTCCCTGCAGCCGTGAGAGGGTTCGTGGATGACATCATCCAGCCGT
CCTCTACTCGTGCTCGGATATGCTGTGACCTGGAAGTCCTGGCCAGCAAGAAGGTCCATCGTCC
TTGGAGGAAGCATGCCAATGTCCCACTGTGAAGAGATCAAAAGAAGAGAGCAACAGTGGAGAAG
CTGGCCTTTTGCAGCCTACCCCTGCCTTCTACAATCATGAAAGAACGGATCTACATACCTTGGA
CACTGATTGAATTGCATAAAGAGTTCTTGTGCCTGGAGAAAAATTATGTGCTCTATTAAAATCT
TCACTGGTGCTTTCTGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_058726	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41818	(Get FASTA)	NCBI Sequence Viewer
	AAH78855	(Get FASTA)	NCBI Sequence Viewer
	EDL77414	(Get FASTA)	NCBI Sequence Viewer
	EDL77415	(Get FASTA)	NCBI Sequence Viewer
	EDL77416	(Get FASTA)	NCBI Sequence Viewer
	P07633	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058726 ⟸ NM_017030
- Peptide Label:	precursor
- UniProtKB:	P07633 (UniProtKB/Swiss-Prot), Q68FZ8 (UniProtKB/TrEMBL), A6I2G1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAAIRIRAMAAGTRLRVLNCGLRTTIRSLCSQPVSVNERIENKRHAALLGGGQRRIDAQHKRG KLTARERISLLLDPGSFVESDMFVEHRCADFGMAAEKNKFPGDSVVTGRGRINGRLVYVFSQDF TVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVI PQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPEVVKSVTNEDVTQEQLGGAKTHTTVS GVAHRAFDNDVDALCNLREFFNFLPLSNQDPAPIRECHDPSDRLVPELDTVVPLESSKAYNMLD IIHAVIDEREFFEIMPNYAKNIVIGFARMNGRTVGIVGNQPNVASGCLDINSSVKGARFVRFCD AFSIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKITVITRKAYGGAYDVMSSKH LLGDTNYAWPTAEIAVMGAKGAVEIIFKGHQDVEAAQAEYVEKFANPFPAAVRGFVDDIIQPSS TRARICCDLEVLASKKVHRPWRKHANVPL hide sequence

RefSeq Acc Id:

ENSRNOP00000021657 ⟸ ENSRNOT00000021657

RefSeq Acc Id:

ENSRNOP00000088818 ⟸ ENSRNOT00000111922

RefSeq Acc Id:

ENSRNOP00000089837 ⟸ ENSRNOT00000096615

RefSeq Acc Id:

ENSRNOP00000084320 ⟸ ENSRNOT00000113920

Protein Domains

CoA carboxyltransferase C-terminal CoA carboxyltransferase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P07633-F1-model_v2	AlphaFold	P07633	1-541	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3265	AgrOrtholog
BioCyc Gene	G2FUF-29364	BioCyc
BioCyc Pathway	PROPIONMET-PWY [propanoyl CoA degradation I]	BioCyc
Ensembl Genes	ENSRNOG00000015869	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000021657	ENTREZGENE
	ENSRNOP00000021657.3	UniProtKB/TrEMBL
	ENSRNOP00000084320.1	UniProtKB/TrEMBL
	ENSRNOP00000088818.1	UniProtKB/TrEMBL
	ENSRNOP00000089837.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021657	ENTREZGENE
	ENSRNOT00000021657.4	UniProtKB/TrEMBL
	ENSRNOT00000096615.1	UniProtKB/TrEMBL
	ENSRNOT00000111922.1	UniProtKB/TrEMBL
	ENSRNOT00000113920.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7108495	IMAGE-MGC_LOAD
InterPro	AcCoA_carboxyl	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ClpP/crotonase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	COA_CT_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	COA_CT_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24624	UniProtKB/TrEMBL
MGC_CLONE	MGC:93516	IMAGE-MGC_LOAD
NCBI Gene	24624	ENTREZGENE
PANTHER	PROPIONYL-COA CARBOXYLASE BETA CHAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROPIONYL-COA CARBOXYLASE BETA CHAIN, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Carboxyl_trans	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pccb	PhenoGen
PROSITE	COA_CT_CTER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	COA_CT_NTER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52096	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZYQ5_RAT	UniProtKB/TrEMBL
	A0A8I6A8K8_RAT	UniProtKB/TrEMBL
	A0A8I6A9J4_RAT	UniProtKB/TrEMBL
	A6I2G1	ENTREZGENE, UniProtKB/TrEMBL
	A6I2G2_RAT	UniProtKB/TrEMBL
	A6I2G3_RAT	UniProtKB/TrEMBL
	F7FPI9_RAT	UniProtKB/TrEMBL
	P07633	ENTREZGENE, UniProtKB/Swiss-Prot
	Q68FZ8	ENTREZGENE
UniProt Secondary	Q68FZ8	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-04	Pccb	propionyl-CoA carboxylase subunit beta	Pccb	propionyl-CoA carboxylase beta subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-20	Pccb	propionyl-CoA carboxylase beta subunit	Pccb	propionyl CoA carboxylase, beta polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Pccb	propionyl CoA carboxylase, beta polypeptide	Pccb	propionyl coenzyme A carboxylase, beta polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pccb	Propionyl Coenzyme A carboxylase, beta polypeptide			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)