Adora3 (adenosine A3 receptor) - Rat Genome Database

Name: Adora3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Adora3 (adenosine A3 receptor) Rattus norvegicus

Analyze

Symbol:

Adora3

Name:

adenosine A3 receptor

RGD ID:

2051

Description:

Enables G protein-coupled adenosine receptor activity. Involved in G protein-coupled receptor signaling pathway; presynaptic modulation of chemical synaptic transmission; and regulation of norepinephrine secretion. Located in presynaptic membrane. Is active in Schaffer collateral - CA1 synapse. Orthologous to human ADORA3 (adenosine A3 receptor); INTERACTS WITH 2,4-dinitrobenzenesulfonic acid; 3-iodobenzyl-5'-N-methylcarboxamidoadenosine; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

A3; Adenosine receptor A3; adenosine receptor A3-like; LOC100911796; putative G-protein coupled receptor; TGPCR1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADORA3 (adenosine A3 receptor)	RGD	RGD
Mus musculus (house mouse):	Adora3 (adenosine A3 receptor)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100980598 (adenosine receptor A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADORA3 (adenosine A3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101973578 (adenosine receptor A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADORA3 (adenosine A3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103224223 (adenosine receptor A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Adora3 (adenosine A3 receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TMIGD3 (transmembrane and immunoglobulin domain containing 3)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Adora3 (adenosine A3 receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ADORA3 (adenosine A3 receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AdoR	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ador-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	adora3.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adora3.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	196,077,042 - 196,080,686 (+)	NCBI		GRCr8
mRatBN7.2	2	193,352,759 - 193,392,946 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	193,388,713 - 193,392,357 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	200,983,156 - 200,986,800 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	198,878,989 - 198,882,630 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	193,695,946 - 193,699,587 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	208,492,231 - 208,536,910 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,530,864 - 208,534,506 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,373,154 - 208,376,803 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	227,900,059 - 227,955,985 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	2	227,743,778 - 227,796,705 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	201,157,782 - 201,161,425 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	201,120,535 - 201,124,179 (+)	NCBI
Celera	2	186,090,081 - 186,093,723 (+)	NCBI		Celera
RH 3.4 Map	2	1369.2	RGD
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Experimental Liver Cirrhosis (ISO)

ischemia (ISO)

myocardial infarction (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrobenzenesulfonic acid (EXP)

3-iodobenzyl-5'-N-methylcarboxamidoadenosine (EXP,ISO)

3-methylcholanthrene (ISO)

acetylsalicylic acid (ISO)

acrylamide (EXP)

adenosine (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

amphotericin B (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (EXP)

dextran sulfate (ISO)

dichlorine (EXP)

diethyl maleate (EXP)

dipyridamole (EXP)

disodium cromoglycate (EXP)

dizocilpine maleate (ISO)

graphite (EXP)

indometacin (ISO)

lipopolysaccharide (ISO)

medroxyprogesterone acetate (ISO)

methamphetamine (EXP,ISO)

methotrexate (EXP,ISO)

N-ethyl-5'-carboxamidoadenosine (ISO)

ozone (EXP,ISO)

phenobarbital (EXP)

phenylephrine (EXP)

phorbol 13-acetate 12-myristate (ISO)

prazosin (EXP)

Ptaquiloside (ISO)

pyrazoles (ISO)

quinolines (ISO)

resveratrol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

scopolamine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium dichromate (ISO)

sulforaphane (ISO)

tamibarotene (ISO)

tetrachloromethane (ISO)

titanium dioxide (EXP,ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium-mediated signaling (ISO)

G protein-coupled adenosine receptor signaling pathway (IBA,ISO)

G protein-coupled receptor signaling pathway (IDA)

histamine secretion by mast cell (ISO)

mast cell degranulation (ISO)

mucus secretion (ISO)

negative regulation of cell migration (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of NF-kappaB transcription factor activity (ISO)

phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO)

positive regulation of calcium-mediated signaling (ISO)

positive regulation of inflammatory response (ISO)

positive regulation of leukocyte migration (ISO)

positive regulation of mast cell degranulation (ISO)

positive regulation of mucus secretion (ISO)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO)

presynaptic modulation of chemical synaptic transmission (EXP,IDA)

regulation of norepinephrine secretion (IMP)

Cellular Component

dendrite (IBA)

neuromuscular junction (ISO)

plasma membrane (IBA,ISO)

presynaptic membrane (IDA)

Schaffer collateral - CA1 synapse (EXP,IDA)

synapse (IBA,ISO)

Molecular Function

G protein-coupled adenosine receptor activity (IBA,IDA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	[Drug therapy of shock].	Bartels O, etal., Fortschr Med. 1978 Mar 30;96(12):653-60.
2.	The role of adenosine A2A and A3 receptors on the differential modulation of norepinephrine and neuropeptide Y release from peripheral sympathetic nerve terminals.	Donoso MV, etal., J Neurochem. 2006 Mar;96(6):1680-95.
3.	Activation of hippocampal adenosine A3 receptors produces a desensitization of A1 receptor-mediated responses in rat hippocampus.	Dunwiddie TV, etal., J Neurosci. 1997 Jan 15;17(2):607-14.
4.	Subtype-specific regulation of receptor internalization and recycling by the carboxyl-terminal domains of the human A1 and rat A3 adenosine receptors: consequences for agonist-stimulated translocation of arrestin3.	Ferguson G, etal., Biochemistry 2002 Dec 17;41(50):14748-61.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
8.	Adenosine A3 receptors are located in neurons of the rat hippocampus.	Lopes LV, etal., Neuroreport. 2003 Aug 26;14(12):1645-8.
9.	Adenosine A(3) receptor activation protects the myocardium from reperfusion/reoxygenation injury.	Maddock HL, etal., Am J Physiol Heart Circ Physiol 2002 Oct;283(4):H1307-13.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	A role for the A3 adenosine receptor in determining tissue levels of cAMP and blood pressure: studies in knock-out mice.	Zhao Z, etal., Biochim Biophys Acta 2000 Mar 17;1500(3):280-90.
15.	Molecular cloning and characterization of an adenosine receptor: the A3 adenosine receptor.	Zhou QY, etal., Proc Natl Acad Sci U S A 1992 Aug 15;89(16):7432-6.

Additional References at PubMed

PMID:1647979	PMID:8612733	PMID:10660615	PMID:10692494	PMID:11214319	PMID:12477932	PMID:12817016	PMID:15240734	PMID:15632090	PMID:15681707	PMID:16943766	PMID:17519974
PMID:17626785	PMID:19740086	PMID:21335481	PMID:21849555	PMID:24311446	PMID:24352876	PMID:24754634	PMID:26297614	PMID:27886186	PMID:31556103	PMID:32461578	PMID:33007835
PMID:35775127

Genomics

Comparative Map Data

Adora3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	196,077,042 - 196,080,686 (+)	NCBI		GRCr8
mRatBN7.2	2	193,352,759 - 193,392,946 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	193,388,713 - 193,392,357 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	200,983,156 - 200,986,800 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	198,878,989 - 198,882,630 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	193,695,946 - 193,699,587 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	208,492,231 - 208,536,910 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,530,864 - 208,534,506 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	2	208,373,154 - 208,376,803 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	227,900,059 - 227,955,985 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	2	227,743,778 - 227,796,705 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	201,157,782 - 201,161,425 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	201,120,535 - 201,124,179 (+)	NCBI
Celera	2	186,090,081 - 186,093,723 (+)	NCBI		Celera
RH 3.4 Map	2	1369.2	RGD
Cytogenetic Map	2	q34	NCBI

ADORA3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	111,499,429 - 111,503,633 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	111,499,429 - 111,503,633 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	112,042,051 - 112,046,255 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	111,827,493 - 111,908,120 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	111,754,096 - 111,758,785	NCBI
Celera	1	110,272,892 - 110,353,227 (-)	NCBI		Celera
Cytogenetic Map	1	p13.2	NCBI
HuRef	1	109,897,418 - 109,977,884 (-)	NCBI		HuRef
CHM1_1	1	112,140,977 - 112,221,562 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	111,514,110 - 111,518,318 (-)	NCBI		T2T-CHM13v2.0

Adora3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	105,811,737 - 105,816,244 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	105,778,174 - 105,816,242 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	105,904,421 - 105,908,928 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	105,870,858 - 105,908,926 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	105,673,776 - 105,726,960 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	106,032,542 - 106,036,410 (+)	NCBI		MGSCv36	mm8
Celera	3	108,059,748 - 108,112,932 (+)	NCBI		Celera
Cytogenetic Map	3	F2.2	NCBI
cM Map	3	46.45	NCBI

LOC100980598
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	115,463,745 - 115,547,180 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	114,611,926 - 114,693,342 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	114,144,642 - 114,225,407 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	126,122,352 - 126,202,396 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	126,122,352 - 126,202,396 (+)	Ensembl	panpan1.1		panPan2

ADORA3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	63,895,408 - 63,898,666 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	63,895,408 - 63,898,666 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	63,408,938 - 63,412,242 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	65,066,829 - 65,070,166 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	65,066,642 - 65,071,049 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	63,801,857 - 63,805,119 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	63,860,662 - 63,863,924 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	64,658,761 - 64,662,034 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101973578
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	17,309,039 - 17,325,264 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936690	152,777 - 168,411 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADORA3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	108,854,357 - 108,873,925 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	108,854,300 - 108,857,769 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	119,036,224 - 119,039,693 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103224223
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	22,043,367 - 22,127,103 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	22,106,190 - 22,123,629 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	36,352,015 - 36,375,319 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adora3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	7,229,093 - 7,232,837 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	7,189,381 - 7,232,919 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Adora3
174 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	201
Count of miRNA genes:	137
Interacting mature miRNAs:	152
Transcripts:	ENSRNOT00000021236, ENSRNOT00000050538
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

Markers in Region

ADORA3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	193,391,343 - 193,391,754 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	208,533,494 - 208,533,904	NCBI	Rnor6.0
Rnor_6.0	2	208,375,791 - 208,376,201	NCBI	Rnor6.0
Rnor_5.0	2	227,795,692 - 227,796,102	UniSTS	Rnor5.0
Rnor_5.0	2	227,954,972 - 227,955,382	UniSTS	Rnor5.0
RGSC_v3.4	2	201,160,413 - 201,160,823	UniSTS	RGSC3.4
Celera	2	186,092,710 - 186,093,120	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH94668

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	193,392,060 - 193,392,199 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	208,534,211 - 208,534,349	NCBI	Rnor6.0
Rnor_6.0	2	208,376,508 - 208,376,646	NCBI	Rnor6.0
Rnor_5.0	2	227,955,689 - 227,955,827	UniSTS	Rnor5.0
Rnor_5.0	2	227,796,409 - 227,796,547	UniSTS	Rnor5.0
RGSC_v3.4	2	201,161,130 - 201,161,268	UniSTS	RGSC3.4
Celera	2	186,093,427 - 186,093,565	UniSTS
RH 3.4 Map	2	1369.2	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

reproductive system
1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001302750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001302751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006233067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001836401	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_001836419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF102804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY011212	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR468632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ075463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M94152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X59249	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X93219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021236 ⟹ ENSRNOP00000021236

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	193,388,713 - 193,392,357 (+)	Ensembl

RefSeq Acc Id:

NM_001302750 ⟹ NP_001289679

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	196,077,042 - 196,080,686 (+)	NCBI
mRatBN7.2	2	193,388,713 - 193,392,357 (+)	NCBI

RefSeq Acc Id:

NM_001302751 ⟹ NP_001289680

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	196,077,042 - 196,080,686 (+)	NCBI
mRatBN7.2	2	193,388,713 - 193,392,357 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001289679	(Get FASTA)	NCBI Sequence Viewer
	NP_001289680	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40680	(Get FASTA)	NCBI Sequence Viewer
	AAC83925	(Get FASTA)	NCBI Sequence Viewer
	AAG35136	(Get FASTA)	NCBI Sequence Viewer
	AAY67748	(Get FASTA)	NCBI Sequence Viewer
	CAA41937	(Get FASTA)	NCBI Sequence Viewer
	CAA63702	(Get FASTA)	NCBI Sequence Viewer
	EDL81823	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021236.3

RefSeq Acc Id:	NP_001289679 ⟸ NM_001302750
- Peptide Label:	isoform a
- UniProtKB:	Q4PKD9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALADIAVG VLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRLSFLVVNLP FSSPHSNRYRTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVG LDYMVFFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLF LFALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILRACR LCQTSDSLDSNLEQTTE hide sequence

RefSeq Acc Id:	NP_001289680 ⟸ NM_001302751
- Peptide Label:	isoform b
- UniProtKB:	Q63792 (UniProtKB/Swiss-Prot), P28647 (UniProtKB/Swiss-Prot), A6HUN6 (UniProtKB/TrEMBL), Q4PKD9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALADIAVG VLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRYRTVTTQRR IWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMVFFSFITWILIPL VVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFLFALCWLPLSIINFVSY FNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILRACRLCQTSDSLDSNLEQTTE hide sequence

Ensembl Acc Id:

ENSRNOP00000021236 ⟸ ENSRNOT00000021236

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P28647-F1-model_v2	AlphaFold	P28647	1-320	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2051	AgrOrtholog
Ensembl Genes	ENSRNOG00000015788	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000050743	Ensembl
Ensembl Transcript	ENSRNOT00000021236.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7453330	IMAGE-MGC_LOAD
InterPro	Adeno_A3_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Adenosn_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:100911796	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:114438	IMAGE-MGC_LOAD
NCBI Gene	Adora3	ENTREZGENE
PANTHER	ADENOSINE RECEPTOR A3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORY RECEPTOR AND ADENOSINE RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	ADORA3	RGD
PhenoGen	Adora3	PhenoGen
PRINTS	ADENOSINEA3R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADENOSINER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015788	RatGTEx
	ENSRNOG00000050743	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HUN6	ENTREZGENE, UniProtKB/TrEMBL
	AA3R_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q4PKD9	ENTREZGENE, UniProtKB/TrEMBL
	Q63792	ENTREZGENE
	Q99P15_RAT	UniProtKB/TrEMBL
UniProt Secondary	Q63792	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-03-01	Adora3	adenosine A3 receptor	LOC100911796	adenosine receptor A3-like	Data merged from RGD:6491091	737654	PROVISIONAL
2012-07-05	LOC100911796	adenosine receptor A3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-11-06	Adora3	adenosine A3 receptor		Adenosine receptor A3	Name updated	625702	APPROVED
2002-06-10	Adora3	Adenosine receptor A3			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains seven transmbembrane domain characteristic of G-protein coupled receptors	631810
gene_expression	expressed in brain	631810
gene_expression	mRNA expressed at high levels in testis	631810
gene_expression	mRNA detected in lung, kidney, heart, brain cortex, striatum, and olfactory bulb
gene_function	binds adenosine with a non-A1, non-A2 receptor specificity	631810
gene_process	may be involved in male reproduction	631810
gene_process	may play a role in remodeling after myocardial cell injury	631763
gene_product	member of the G-protein coupled receptor family	631810
gene_protein	protein sequence contains 320 amino acid residues	631810

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD