Advanced Search (OLGA)

Gene: Adat3 (adenosine deaminase, tRNA-specific 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Adat3

Name:

adenosine deaminase, tRNA-specific 3

RGD ID:

1642417

Description:

Predicted to enable catalytic activity and metal ion binding activity. Predicted to contribute to tRNA-specific adenosine-34 deaminase activity. Predicted to be involved in tRNA processing. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in neurodevelopmental disorder with brain abnormalities, poor growth, and dysmorphic facies. Orthologous to human ADAT3 (adenosine deaminase tRNA specific 3); INTERACTS WITH acrylamide; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

adenosine deaminase, tRNA-specific 3, TAD3 homolog; adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae); MGC112753; probable inactive tRNA-specific adenosine deaminase-like protein 3; tRNA-specific adenosine deaminase-like protein 3; tRNA-specific adenosine-34 deaminase subunit ADAT3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADAT3 (adenosine deaminase tRNA specific 3)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Adat3 (adenosine deaminase, tRNA-specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADAT3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADAT3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Adat3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADAT3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADAT3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ADAT3 (adenosine deaminase tRNA specific 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Adat3 (adenosine deaminase, tRNA-specific 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adat3 (adenosine deaminase tRNA specific 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10927	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TAD3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y47D3A.14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,759,758 - 9,761,127 (-)	NCBI		GRCr8
mRatBN7.2	7	9,109,070 - 9,113,673 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	9,101,187 - 9,115,340 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,987,333 - 11,988,702 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,862,845 - 13,864,214 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,728,888 - 11,730,257 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,977,285 - 11,981,814 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	7	12,144,810 - 12,146,179 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	10,619,919 - 10,621,288 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	7,291,257 - 7,292,626 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adat3	Rat	cyclic hematopoiesis		ISO	ADAT3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cyclical neutropenia	ClinVar	PMID:28492532
Adat3	Rat	genetic disease		ISO	ADAT3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 and PMID:28492532
Adat3	Rat	intellectual disability		ISO	ADAT3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar	PMID:25741868
Adat3	Rat	microcephaly		ISO	ADAT3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Microcephaly	ClinVar	PMID:25741868
Adat3	Rat	neurodevelopmental disorder with brain abnormalities, poor growth, and dysmorphic facies		ISO	ADAT3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:23620220 more ...
Adat3	Rat	Neurodevelopmental Disorders		ISO	ADAT3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Adat3	Rat	progressive myoclonus epilepsy 9		ISO	ADAT3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Progressive myoclonic epilepsy type 9	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adat3	Rat	neurodevelopmental disorder with brain abnormalities, poor growth, and dysmorphic facies		ISO	ADAT3 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adat3	Rat	1,2-dichloroethane	decreases expression	ISO	Adat3 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of ADAT3 mRNA	CTD	PMID:28189721 and PMID:28960355
Adat3	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	Adat3 (Mus musculus)	6480464	bisphenol S results in decreased methylation of ADAT3 exon	CTD	PMID:33297965
Adat3	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Adat3 (Mus musculus)	6480464	bisphenol S affects the methylation of ADAT3 gene	CTD	PMID:31683443
Adat3	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of ADAT3 mRNA	CTD	PMID:28959563
Adat3	Rat	aristolochic acid A	increases expression	ISO	ADAT3 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of ADAT3 mRNA	CTD	PMID:33212167
Adat3	Rat	arsenous acid	multiple interactions	ISO	ADAT3 (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to ADAT3 protein]	CTD	PMID:26598702
Adat3	Rat	benzo[a]pyrene	increases methylation	ISO	Adat3 (Mus musculus)	6480464	Benzo(a)pyrene results in increased methylation of ADAT3 3' UTR and Benzo(a)pyrene results in increased methylation of ADAT3 exon	CTD	PMID:27901495
Adat3	Rat	benzo[a]pyrene	decreases methylation	ISO	ADAT3 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of ADAT3 5' UTR	CTD	PMID:27901495
Adat3	Rat	beta-lapachone	decreases expression	ISO	ADAT3 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of ADAT3 mRNA	CTD	PMID:38218311
Adat3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ADAT3 mRNA	CTD	PMID:25181051
Adat3	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of ADAT3 promoter	CTD	PMID:22457795
Adat3	Rat	carbon nanotube	increases expression	ISO	Adat3 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of ADAT3 mRNA	CTD	PMID:25554681
Adat3	Rat	copper(II) sulfate	increases expression	ISO	ADAT3 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of ADAT3 mRNA	CTD	PMID:19549813
Adat3	Rat	DDE	decreases expression	ISO	ADAT3 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of ADAT3 mRNA	CTD	PMID:38568856
Adat3	Rat	diarsenic trioxide	multiple interactions	ISO	ADAT3 (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to ADAT3 protein]	CTD	PMID:26598702
Adat3	Rat	dibenz[a,h]anthracene	decreases expression	ISO	Adat3 (Mus musculus)	6480464	1 more ...	CTD	PMID:26377693
Adat3	Rat	Dibutyl phosphate	affects expression	ISO	ADAT3 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of ADAT3 mRNA	CTD	PMID:37042841
Adat3	Rat	disodium selenite	increases expression	ISO	ADAT3 (Homo sapiens)	6480464	Sodium Selenite results in increased expression of ADAT3 mRNA	CTD	PMID:18175754
Adat3	Rat	ethanol	affects expression	ISO	Adat3 (Mus musculus)	6480464	Ethanol affects the expression of ADAT3 mRNA	CTD	PMID:30319688
Adat3	Rat	Licochalcone B	increases expression	ISO	ADAT3 (Homo sapiens)	6480464	licochalcone B results in increased expression of ADAT3 mRNA	CTD	PMID:33647349
Adat3	Rat	methotrexate	decreases expression	ISO	ADAT3 (Homo sapiens)	6480464	Methotrexate results in decreased expression of ADAT3 mRNA	CTD	PMID:17400583
Adat3	Rat	paracetamol	increases expression	ISO	ADAT3 (Homo sapiens)	6480464	Acetaminophen results in increased expression of ADAT3 mRNA	CTD	PMID:29067470
Adat3	Rat	resveratrol	multiple interactions	ISO	ADAT3 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of ADAT3 mRNA	CTD	PMID:23557933
Adat3	Rat	rotenone	decreases expression	ISO	ADAT3 (Homo sapiens)	6480464	Rotenone results in decreased expression of ADAT3 mRNA	CTD	PMID:29955902
Adat3	Rat	silver atom	decreases expression	ISO	Adat3 (Mus musculus)	6480464	Silver results in decreased expression of ADAT3 mRNA	CTD	PMID:27131904
Adat3	Rat	silver(0)	decreases expression	ISO	Adat3 (Mus musculus)	6480464	Silver results in decreased expression of ADAT3 mRNA	CTD	PMID:27131904
Adat3	Rat	sodium arsenite	decreases expression	ISO	ADAT3 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of ADAT3 mRNA	CTD	PMID:38568856
Adat3	Rat	sunitinib	increases expression	ISO	ADAT3 (Homo sapiens)	6480464	Sunitinib results in increased expression of ADAT3 mRNA	CTD	PMID:31533062
Adat3	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of ADAT3 mRNA	CTD	PMID:31150632
Adat3	Rat	titanium dioxide	decreases expression	ISO	Adat3 (Mus musculus)	6480464	titanium dioxide results in decreased expression of ADAT3 mRNA	CTD	PMID:29264374
Adat3	Rat	toluene	decreases expression	ISO	ADAT3 (Homo sapiens)	6480464	Toluene results in decreased expression of ADAT3 mRNA	CTD	PMID:26717081
Adat3	Rat	toluene	increases methylation	ISO	ADAT3 (Homo sapiens)	6480464	Toluene results in increased methylation of ADAT3 gene	CTD	PMID:26717081
Adat3	Rat	urethane	increases expression	ISO	ADAT3 (Homo sapiens)	6480464	Urethane results in increased expression of ADAT3 mRNA	CTD	PMID:28818685
Adat3	Rat	valproic acid	increases methylation	ISO	ADAT3 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of ADAT3 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adat3	Rat	tRNA processing	involved_in	IEA	UniProtKB-KW:KW-0819	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adat3	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN001668995 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Adat3	Rat	nucleus	is_active_in	IBA	PANTHER:PTN001668995 and TAIR:locus:2176816	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Adat3	Rat	catalytic activity	enables	IEA	InterPro:IPR016193	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Adat3	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Adat3	Rat	protein binding	enables	ISO	ADAT3 (Homo sapiens)	1624291	UniProtKB:O60504 more ...	RGD	PMID:32296183 and PMID:33961781
Adat3	Rat	tRNA-specific adenosine-34 deaminase activity	contributes_to	IBA	PANTHER:PTN001668995 and PomBase:SPAP27G11.04c	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334	PMID:15632090

Adat3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,759,758 - 9,761,127 (-)	NCBI		GRCr8
mRatBN7.2	7	9,109,070 - 9,113,673 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	9,101,187 - 9,115,340 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,987,333 - 11,988,702 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,862,845 - 13,864,214 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,728,888 - 11,730,257 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,977,285 - 11,981,814 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	7	12,144,810 - 12,146,179 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	10,619,919 - 10,621,288 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	7,291,257 - 7,292,626 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

ADAT3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	1,905,399 - 1,913,447 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	1,905,399 - 1,913,447 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	1,905,398 - 1,913,446 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	1,856,417 - 1,864,446 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	1,839,500 - 1,847,520 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	1,676,853 - 1,684,944 (+)	NCBI		HuRef
CHM1_1	19	1,904,960 - 1,913,035 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	1,876,716 - 1,884,760 (+)	NCBI		T2T-CHM13v2.0

Adat3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	80,438,714 - 80,443,488 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	80,438,714 - 80,443,488 (+)	Ensembl		GRCm39 Ensembl
GRCm39 Ensembl	10	80,441,855 - 80,451,618 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	80,602,880 - 80,607,654 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	80,606,021 - 80,615,784 (+)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	10	80,602,880 - 80,607,654 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	80,065,625 - 80,070,399 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
Celera	10	81,620,704 - 81,625,478 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

ADAT3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	6,276,650 - 6,284,607 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	5,507,422 - 5,515,555 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	910,954 - 912,687 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	1,890,221 - 1,892,044 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	1,890,437 - 1,891,748 (+)	Ensembl	panpan1.1		panPan2

ADAT3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	57,062,706 - 57,065,492 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	56,856,950 - 56,861,365 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	57,794,907 - 57,799,327 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	20	56,851,736 - 56,856,137 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	57,331,731 - 57,336,147 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	57,532,745 - 57,537,165 (-)	NCBI		UU_Cfam_GSD_1.0

Adat3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	216,723,639 - 216,730,690 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936588	1,108,790 - 1,111,287 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADAT3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	76,628,633 - 76,634,262 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	76,628,626 - 76,634,282 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	77,333,682 - 77,339,154 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADAT3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	1,695,897 - 1,705,718 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666081	7,082,891 - 7,090,329 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Adat3
9 total Variants

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001103361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC093394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000095368 ⟹ ENSRNOP00000089590

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	9,101,187 - 9,115,340 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106355 ⟹ ENSRNOP00000077221

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	9,101,502 - 9,114,507 (-)	Ensembl

RefSeq Acc Id:

NM_001103361 ⟹ NP_001096831

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,759,758 - 9,761,127 (-)	NCBI
mRatBN7.2	7	9,109,073 - 9,110,442 (-)	NCBI
Rnor_6.0	7	11,977,285 - 11,978,654 (-)	NCBI
Rnor_5.0	7	12,144,810 - 12,146,179 (-)	NCBI
RGSC_v3.4	7	10,619,919 - 10,621,288 (-)	RGD
Celera	7	7,291,257 - 7,292,626 (-)	RGD

Sequence:

show sequence

CTGTCTCCCACAGTCGAGCCCCGCTGAGGATGGAGCCCACCTCAGGCTTTGCAGAGCAACCTGGGCCTGAGAAGGTTGAAAGTGAGGAGCAAGAGCCGGCGCAGTGGCAAGCCCTCCCTGTCCTGTCG
GAGCAGCAGTCGGGGGCCGTGGAGCTGGTACTGGCCTACGCTGCACCTGTCCTGGACAAGCGCCAGACGTCCCGCCTCCTCCGGGAGGTGTCTGCTGTCTATCCACTTCCTGCCCAGCCCCACCTCAA
ACGGGTGCGCCCCAGCCGCAGTGCAGGCGGTGCGCACTCGTCGGATCTGCTGTTGTGCCTGGCCGGGCCGTCCGCGGGCCCGCGCTCGCTGGCCGAGCTCCTTCCGAGGCCGGCCGTGGACCCGCGCG
GCCTGGGCACACCTTTCTTGGTGCCTGTGCCTGCCCGGCCGCCCCTTACCCGGAGCCAGTTTGAGGAGGCGCGGGCCCACTGGCCCACATCCTTCCATGAAGACAAGCAGGTGACCAGTGCTTTGGCC
GGGCAACTCTTCTCTGCGCAGGCTCGAGCCGCCATGCAGACCCACATGGAACGGGCAGTACGTGCGGCCCAGAGGGCAGCCGCGCAGGGGCTGCGGGCAGTGGGTGCCGTCGTGGTGGACCCAGCCTC
GGACCATGTGTTGGCCACAGGCCATGACTGCTGCAGCGAAGCCAGCCCCTTGCTGCACGCCGTCATGGTATGCATCGACCTGGTGGCCCAGGGGCAGGGCCGAGGCTCCTGCGACCTCAGACGCCACC
CAGCTTGCTCCTTCACACAGGCCACTGCCACTCAGAGCGCCCGTGCTGGTAGCGTGCGCAAGCTGGACGAAGATAGCCTGCCCTATGTGTGCACCGGTTATGACCTGTACGTCACCCGAGAGCCCTGT
GTCATGTGCGCCATGGCCCTCGTCCACGCCCGTATCCAGCGTGTCTTCTATGGGGCGCCCTCACCCGATGGCGCCTTGGGCACGCGCTTCCGTGTCCACGCTCGGCCAGACCTCAACCACCGCTTCCA
GGTGTTCCGCGGCATCCTCGAGGACCAGTGCCGCCAGCTGGACCCCGACCCGTAGGCCTCGTGACCTTCTGCTTCTAGACCATTCTCTGCTCCTGGCCAGCCCGCATCCCCTGCAGCTCCATGGCCTT
GGGCCTGGGGTCCCGCCCTCTGTGTCTGAGGACACTGACCACCTGTGCCAGACTGTGGGCCTCTCAGTTTCGAGACTGCAGCTTCTCTGGTGGCTGCGACACCGTGGGGCTCTGCTCTGCTTGCAAGC
CCAGTGGCTGCCTTAGAGTCCCCGTGGTGGTCCTCTAGGCTCGGGGCAGGGAGCAGCCATCGAGTGTGAAAATAAAGCACCTCAAACCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001096831	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH93394	(Get FASTA)	NCBI Sequence Viewer
	EDL89262	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000089590
	ENSRNOP00000089590.1
GenBank Protein	Q561R2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001096831 ⟸ NM_001103361

- UniProtKB:

Q561R2 (UniProtKB/Swiss-Prot), A6K8J2 (UniProtKB/TrEMBL), A0A8I5XVX2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPTSGFAEQPGPEKVESEEQEPAQWQALPVLSEQQSGAVELVLAYAAPVLDKRQTSRLLREVSAVYPLPAQPHLKRVRPSRSAGGAHSSDLLLCLAGPSAGPRSLAELLPRPAVDPRGLGTPFLVPV
PARPPLTRSQFEEARAHWPTSFHEDKQVTSALAGQLFSAQARAAMQTHMERAVRAAQRAAAQGLRAVGAVVVDPASDHVLATGHDCCSEASPLLHAVMVCIDLVAQGQGRGSCDLRRHPACSFTQATA
TQSARAGSVRKLDEDSLPYVCTGYDLYVTREPCVMCAMALVHARIQRVFYGAPSPDGALGTRFRVHARPDLNHRFQVFRGILEDQCRQLDPDP

hide sequence

Ensembl Acc Id:

ENSRNOP00000089590 ⟸ ENSRNOT00000095368

Ensembl Acc Id:

ENSRNOP00000077221 ⟸ ENSRNOT00000106355

Protein Domains

CMP/dCMP-type deaminase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q561R2-F1-model_v2	AlphaFold	Q561R2	1-349	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34954	BioCyc
Ensembl Genes	ENSRNOG00000063591	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000095368	ENTREZGENE
	ENSRNOT00000095368.1	UniProtKB/Swiss-Prot
Gene3D-CATH	Cytidine Deaminase, domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7388692	IMAGE-MGC_LOAD
InterPro	CMP_dCMP_dom	UniProtKB/Swiss-Prot
	Cytidine_deaminase-like	UniProtKB/Swiss-Prot
KEGG Report	rno:100125374	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112753	IMAGE-MGC_LOAD
NCBI Gene	100125374	ENTREZGENE
PANTHER	CYTOSINE DEAMINASE FAMILY MEMBER	UniProtKB/Swiss-Prot
	INACTIVE TRNA-SPECIFIC ADENOSINE DEAMINASE-LIKE PROTEIN 3-RELATED	UniProtKB/Swiss-Prot
Pfam	dCMP_cyt_deam_1	UniProtKB/Swiss-Prot
PhenoGen	Adat3	PhenoGen
PROSITE	CYT_DCMP_DEAMINASES_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000063591	RatGTEx
Superfamily-SCOP	SSF53927	UniProtKB/Swiss-Prot
UniProt	A0A8I5XVX2	ENTREZGENE, UniProtKB/TrEMBL
	A6K8J2	ENTREZGENE, UniProtKB/TrEMBL
	ADAT3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-07-28	Adat3	adenosine deaminase, tRNA-specific 3	Adat3	adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Adat3	adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae)	Adat3	adenosine deaminase, tRNA-specific 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-09-15	Adat3	adenosine deaminase, tRNA-specific 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM