Advanced Search (OLGA)

Gene: Dph2 (DPH2 homolog) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Dph2

Name:

DPH2 homolog

RGD ID:

1623210

MGI Page

MGI

Description:

Predicted to enable 4 iron, 4 sulfur cluster binding activity. Predicted to contribute to 2-(3-amino-3-carboxypropyl)histidine synthase activity. Predicted to be involved in protein histidyl modification to diphthamide. Part of 2-(3-amino-3-carboxypropyl)histidine synthase complex. Is expressed in liver lobe. Human ortholog(s) of this gene implicated in diphthamide deficiency syndrome 2. Orthologous to human DPH2 (diphthamide biosynthesis 2).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2-(3-amino-3-carboxypropyl)histidine synthase subunit 2; 9130020C19Rik; AI467389; diphthamide biosynthesis protein 2; diphthamide biosynthesis protein 2 homolog-like 2; diphtheria toxin resistance protein 2; diptheria toxin resistance protein required for diphthamide biosynthesis (Saccharomyces)-like 1; diptheria toxin resistance protein required for diphthamide biosynthesis (Saccharomyces)-like 2; DPH2-like 2; Dph2l2; mmDph2; S-adenosyl-L-methionine:L-histidine 3-amino-3-carboxypropyltransferase DPH2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DPH2 (diphthamide biosynthesis 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Dph2 (diphthamide biosynthesis 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dph2 (diphthamide biosynthesis 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DPH2 (diphthamide biosynthesis 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DPH2 (diphthamide biosynthesis 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dph2 (diphthamide biosynthesis 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DPH2 (diphthamide biosynthesis 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DPH2 (diphthamide biosynthesis 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dph2 (diphthamide biosynthesis 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Dph2 (diphthamide biosynthesis 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DPH2 (diphthamide biosynthesis 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dph2 (DPH2 homolog (S. cerevisiae))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Saccharomyces cerevisiae (baker's yeast):	DPH2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7265	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dph-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dph2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	117,745,838 - 117,749,220 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	117,745,840 - 117,749,229 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	117,888,643 - 117,892,003 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	117,888,643 - 117,892,032 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	117,561,248 - 117,564,608 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	117,386,575 - 117,389,935 (-)	NCBI		MGSCv36	mm8
Celera	4	116,603,810 - 116,607,170 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	53.74	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dph2	Mouse	Charcot-Marie-Tooth disease dominant intermediate C		ISO	DPH2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease dominant intermediate C	ClinVar	PMID:28492532
Dph2	Mouse	developmental and epileptic encephalopathy		ISO	DPH2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy	ClinVar	PMID:23252400 more ...
Dph2	Mouse	Developmental Disabilities		ISO	DPH2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Global developmental delay	ClinVar	PMID:25741868 and PMID:32576952
Dph2	Mouse	diphthamide deficiency syndrome		ISO	DPH2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: diphthamide-deficiency syndrome	ClinVar	PMID:25741868 more ...
Dph2	Mouse	diphthamide deficiency syndrome 2		ISO	DPH2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental delay with short stature more ...	ClinVar	PMID:25741868 more ...
Dph2	Mouse	early infantile epileptic encephalopathy		ISO	DPH2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Early infantile epileptic encephalopathy	ClinVar	PMID:23252400 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dph2	Mouse	diphthamide deficiency syndrome 2		ISO	DPH2 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dph2	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DPH2 mRNA	CTD	PMID:36331819
Dph2	Mouse	1,2-dimethylhydrazine	increases expression	EXP		6480464	1 and 2-Dimethylhydrazine results in increased expression of DPH2 mRNA	CTD	PMID:22206623
Dph2	Mouse	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of DPH2 mRNA]	CTD	PMID:22206623
Dph2	Mouse	17beta-estradiol	increases expression	ISO	DPH2 (Homo sapiens)	6480464	Estradiol results in increased expression of DPH2 mRNA	CTD	PMID:23019147 and PMID:31614463
Dph2	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of DPH2 mRNA	CTD	PMID:21570461
Dph2	Mouse	3-chloropropane-1,2-diol	increases expression	ISO	Dph2 (Rattus norvegicus)	6480464	alpha-Chlorohydrin results in increased expression of DPH2 protein	CTD	PMID:34915118
Dph2	Mouse	4,4'-sulfonyldiphenol	increases methylation	ISO	DPH2 (Homo sapiens)	6480464	bisphenol S results in increased methylation of DPH2 gene	CTD	PMID:31601247
Dph2	Mouse	acrolein	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of DPH2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of DPH2 mRNA	CTD	PMID:32699268
Dph2	Mouse	acrylamide	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Acrylamide results in decreased expression of DPH2 mRNA	CTD	PMID:32763439
Dph2	Mouse	all-trans-retinoic acid	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Tretinoin results in decreased expression of DPH2 mRNA	CTD	PMID:23724009 and PMID:33167477
Dph2	Mouse	alpha-pinene	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of DPH2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of DPH2 mRNA	CTD	PMID:32699268
Dph2	Mouse	arsane	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of DPH2 mRNA	CTD	PMID:39836092
Dph2	Mouse	arsenic atom	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of DPH2 mRNA	CTD	PMID:39836092
Dph2	Mouse	arsenous acid	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to DPH2 protein]	CTD	PMID:26598702
Dph2	Mouse	atrazine	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Atrazine results in decreased expression of DPH2 mRNA	CTD	PMID:22378314
Dph2	Mouse	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of DPH2 mRNA	CTD	PMID:19770486
Dph2	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of DPH2 mRNA	CTD	PMID:22228805
Dph2	Mouse	beta-lapachone	increases expression	ISO	DPH2 (Homo sapiens)	6480464	beta-lapachone results in increased expression of DPH2 mRNA	CTD	PMID:38218311
Dph2	Mouse	bisphenol A	increases expression	ISO	Dph2 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of DPH2 mRNA	CTD	PMID:30816183 more ...
Dph2	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DPH2 mRNA	CTD	PMID:33221593
Dph2	Mouse	cadmium atom	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DPH2 mRNA	CTD	PMID:35301059
Dph2	Mouse	cadmium dichloride	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of DPH2 mRNA	CTD	PMID:38568856
Dph2	Mouse	cadmium dichloride	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DPH2 mRNA	CTD	PMID:35301059
Dph2	Mouse	carbon nanotube	increases expression	EXP		6480464	Nanotubes more ...	CTD	PMID:25554681
Dph2	Mouse	chlorpyrifos	increases expression	EXP		6480464	Chlorpyrifos results in increased expression of DPH2 mRNA	CTD	PMID:37019170
Dph2	Mouse	cisplatin	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Cisplatin results in decreased expression of DPH2 mRNA	CTD	PMID:27594783
Dph2	Mouse	cobalt dichloride	increases expression	ISO	Dph2 (Rattus norvegicus)	6480464	cobaltous chloride results in increased expression of DPH2 mRNA	CTD	PMID:24386269
Dph2	Mouse	copper(II) sulfate	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of DPH2 mRNA	CTD	PMID:19549813
Dph2	Mouse	cylindrospermopsin	increases expression	ISO	DPH2 (Homo sapiens)	6480464	cylindrospermopsin results in increased expression of DPH2 mRNA	CTD	PMID:24921660
Dph2	Mouse	diarsenic trioxide	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to DPH2 protein]	CTD	PMID:26598702
Dph2	Mouse	diazinon	increases methylation	ISO	DPH2 (Homo sapiens)	6480464	Diazinon results in increased methylation of DPH2 gene	CTD	PMID:22964155
Dph2	Mouse	Dibutyl phosphate	affects expression	ISO	DPH2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of DPH2 mRNA	CTD	PMID:37042841
Dph2	Mouse	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of DPH2 mRNA	CTD	PMID:21266533
Dph2	Mouse	dicrotophos	increases expression	ISO	DPH2 (Homo sapiens)	6480464	dicrotophos results in increased expression of DPH2 mRNA	CTD	PMID:28302478
Dph2	Mouse	dioxygen	multiple interactions	EXP		6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of DPH2 mRNA	CTD	PMID:30529165
Dph2	Mouse	endosulfan	increases expression	ISO	Dph2 (Rattus norvegicus)	6480464	Endosulfan results in increased expression of DPH2 mRNA	CTD	PMID:29391264
Dph2	Mouse	enzyme inhibitor	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of DPH2 protein	CTD	PMID:23301498
Dph2	Mouse	ethyl methanesulfonate	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of DPH2 mRNA	CTD	PMID:23649840
Dph2	Mouse	folic acid	multiple interactions	EXP		6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of DPH2 mRNA]	CTD	PMID:22206623
Dph2	Mouse	FR900359	affects phosphorylation	ISO	DPH2 (Homo sapiens)	6480464	FR900359 affects the phosphorylation of DPH2 protein	CTD	PMID:37730182
Dph2	Mouse	gentamycin	increases expression	ISO	Dph2 (Rattus norvegicus)	6480464	Gentamicins results in increased expression of DPH2 mRNA	CTD	PMID:33387578
Dph2	Mouse	hydrogen peroxide	affects expression	ISO	DPH2 (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of DPH2 mRNA	CTD	PMID:20044591
Dph2	Mouse	irinotecan	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Irinotecan analog results in decreased expression of DPH2 mRNA	CTD	PMID:18927307
Dph2	Mouse	manganese atom	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of DPH2 mRNA	CTD	PMID:39836092
Dph2	Mouse	manganese(0)	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of DPH2 mRNA	CTD	PMID:39836092
Dph2	Mouse	manganese(II) chloride	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of DPH2 mRNA	CTD	PMID:39836092
Dph2	Mouse	methyl methanesulfonate	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of DPH2 mRNA	CTD	PMID:23649840
Dph2	Mouse	nickel atom	increases expression	ISO	DPH2 (Homo sapiens)	6480464	Nickel results in increased expression of DPH2 mRNA	CTD	PMID:25583101
Dph2	Mouse	ozone	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of DPH2 mRNA more ...	CTD	PMID:32699268
Dph2	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of DPH2 mRNA	CTD	PMID:17562736
Dph2	Mouse	paracetamol	increases expression	ISO	Dph2 (Rattus norvegicus)	6480464	Acetaminophen results in increased expression of DPH2 mRNA	CTD	PMID:33387578
Dph2	Mouse	pentachlorophenol	increases expression	EXP		6480464	Pentachlorophenol results in increased expression of DPH2 mRNA	CTD	PMID:23892564
Dph2	Mouse	perfluorononanoic acid	increases expression	ISO	DPH2 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in increased expression of DPH2 mRNA	CTD	PMID:32588087
Dph2	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DPH2 mRNA	CTD	PMID:36331819
Dph2	Mouse	sodium arsenite	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of DPH2 mRNA	CTD	PMID:38568856
Dph2	Mouse	sodium arsenite	multiple interactions	ISO	DPH2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of DPH2 mRNA	CTD	PMID:39836092
Dph2	Mouse	Soman	increases expression	ISO	Dph2 (Rattus norvegicus)	6480464	Soman results in increased expression of DPH2 mRNA	CTD	PMID:19281266
Dph2	Mouse	temozolomide	increases expression	ISO	DPH2 (Homo sapiens)	6480464	Temozolomide results in increased expression of DPH2 mRNA	CTD	PMID:31758290
Dph2	Mouse	thiram	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Thiram results in decreased expression of DPH2 mRNA	CTD	PMID:38568856
Dph2	Mouse	titanium dioxide	decreases expression	EXP		6480464	titanium dioxide results in decreased expression of DPH2 mRNA	CTD	PMID:29264374
Dph2	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of DPH2 gene	CTD	PMID:35295148
Dph2	Mouse	tungsten	increases expression	EXP		6480464	Tungsten results in increased expression of DPH2 mRNA	CTD	PMID:30912803
Dph2	Mouse	urethane	decreases expression	ISO	DPH2 (Homo sapiens)	6480464	Urethane results in decreased expression of DPH2 mRNA	CTD	PMID:28818685
Dph2	Mouse	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of DPH2 mRNA	CTD	PMID:21427059
Dph2	Mouse	valproic acid	increases expression	ISO	DPH2 (Homo sapiens)	6480464	Valproic Acid results in increased expression of DPH2 mRNA	CTD	PMID:23179753

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dph2	Mouse	protein histidyl modification to diphthamide	involved_in	IEA	UniPathway:UPA00559	2290270		UniProt	GO_REF:0000041
Dph2	Mouse	protein histidyl modification to diphthamide	involved_in	ISS	UniProtKB:P32461	2290270		UniProt	GO_REF:0000024
Dph2	Mouse	protein histidyl modification to diphthamide	involved_in	IBA	PANTHER:PTN000079945 more ...	2290270		GO_Central	GO_REF:0000033
Dph2	Mouse	protein histidyl modification to diphthamide	involved_in	ISO	UniProtKB:Q9BQC3	2290270		GO_Central	GO_REF:0000119

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dph2	Mouse	2-(3-amino-3-carboxypropyl)histidine synthase complex	part_of	IDA		2290270	PMID:15485916	MGI	PMID:15485916
Dph2	Mouse	2-(3-amino-3-carboxypropyl)histidine synthase complex	part_of	ISS	UniProtKB:P32461	2290270		UniProt	GO_REF:0000024
Dph2	Mouse	cellular_component	is_active_in	ND		2290270		MGI	GO_REF:0000015
Dph2	Mouse	protein-containing complex	part_of	IDA		2290270	PMID:15485916	MGI	PMID:15485916

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dph2	Mouse	2-(3-amino-3-carboxypropyl)histidine synthase activity	enables	ISO	UniProtKB:Q9BQC3	2290270		GO_Central	GO_REF:0000119
Dph2	Mouse	2-(3-amino-3-carboxypropyl)histidine synthase activity	contributes_to	ISS	UniProtKB:P32461	2290270		UniProt	GO_REF:0000024
Dph2	Mouse	4 iron, 4 sulfur cluster binding	enables	ISS	UniProtKB:P32461	2290270		UniProt	GO_REF:0000024
Dph2	Mouse	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	2290270		UniProt	GO_REF:0000043
Dph2	Mouse	protein binding	enables	IPI	UniProtKB:Q5NCQ5	2290270	PMID:15485916	IntAct	PMID:15485916

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dph2	Mouse	preweaning lethality, complete penetrance		IEA		5509061		MGI

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:15485916	PMID:15782199	PMID:16141072	PMID:16141073
PMID:16602821	PMID:18799693	PMID:21267068	PMID:21677750	PMID:21873635	PMID:30973865	PMID:38355793	PMID:38822427

Dph2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	117,745,838 - 117,749,220 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	117,745,840 - 117,749,229 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	117,888,643 - 117,892,003 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	117,888,643 - 117,892,032 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	117,561,248 - 117,564,608 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	117,386,575 - 117,389,935 (-)	NCBI		MGSCv36	mm8
Celera	4	116,603,810 - 116,607,170 (-)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	53.74	NCBI

DPH2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	43,970,010 - 43,973,369 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	43,970,000 - 43,973,369 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	44,435,682 - 44,439,041 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	44,208,240 - 44,211,630 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	42,719,187 - 42,722,577 (+)	NCBI		Celera
Cytogenetic Map	1	p34.1	NCBI
HuRef	1	42,551,206 - 42,554,596 (+)	NCBI		HuRef
CHM1_1	1	44,551,906 - 44,555,296 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	43,841,090 - 43,844,449 (+)	NCBI		T2T-CHM13v2.0

Dph2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	136,713,868 - 136,716,828 (-)	NCBI		GRCr8
mRatBN7.2	5	131,428,434 - 131,431,394 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	131,428,268 - 131,431,395 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	134,133,497 - 134,136,457 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	135,888,116 - 135,891,076 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	135,910,538 - 135,913,498 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	136,723,398 - 136,726,358 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	136,723,406 - 136,726,358 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	140,512,447 - 140,515,407 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	138,354,594 - 138,357,554 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	138,359,819 - 138,362,780 (-)	NCBI
Celera	5	129,976,628 - 129,979,588 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

Dph2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955537	3,496,688 - 3,500,147 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955537	3,496,688 - 3,500,147 (+)	NCBI	ChiLan1.0	ChiLan1.0

DPH2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	182,836,316 - 182,840,190 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	181,977,648 - 181,981,523 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	43,271,349 - 43,275,162 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	44,643,142 - 44,646,545 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	44,643,142 - 44,646,545 (+)	Ensembl	panpan1.1		panPan2

DPH2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	16,287,300 - 16,291,079 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	16,288,370 - 16,291,032 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	16,408,187 - 16,411,963 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	16,441,825 - 16,445,608 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	16,441,825 - 16,445,591 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	16,240,687 - 16,244,460 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	16,309,692 - 16,313,468 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	16,382,434 - 16,386,210 (-)	NCBI		UU_Cfam_GSD_1.0

Dph2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	59,463,929 - 59,467,505 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	25,288,250 - 25,293,382 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	25,288,714 - 25,292,287 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DPH2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	167,322,332 - 167,326,241 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	167,322,197 - 167,327,760 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	154,992,168 - 154,992,872 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DPH2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	88,832,556 - 88,836,318 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	88,831,322 - 88,836,355 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	28,091,356 - 28,095,097 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dph2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624892	3,251,270 - 3,254,464 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624892	3,251,243 - 3,254,706 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Dph2
194 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	1148
Count of miRNA genes:	530
Interacting mature miRNAs:	645
Transcripts:	ENSMUST00000030265, ENSMUST00000126554, ENSMUST00000139332, ENSMUST00000183773
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12904006	Cfq1_m	conditioned fear QTL 1 (mouse)					4	117177646	120107755	Mouse
13824982	Svwq1_m	seminal vesicle weight QTL 1 (mouse)					4	89888237	118857197	Mouse
11532714	Sluc43_m	susceptibility to lung cancer 43 (mouse)					4	46642108	123127211	Mouse
10047132	Albq19_m	albuminuria QTL 19 (mouse)			Not determined		4	112824389	146824389	Mouse
12904002	Opfaq9_m	open field activity QTL 9 (mouse)					4	92975790	126975790	Mouse
4141623	W6q13_m	weight 6 weeks QTL 13 (mouse)			Not determined			88982069	140468203	Mouse
12910797	Pwgrq4_m	pre-weaning growth rate QTL 4 (mouse)					4	105835310	141433838	Mouse
25314312	Syncl2_m	synaptonemal complex length 2 (mouse)					4	65718237	146584457	Mouse
1357726	Lnopy1_m	lens opacity 1 (mouse)			Not determined		4	85428838	119429037	Mouse
12910794	Pwbwq8_m	post-weaning body weight QTL 8 (mouse)					4	105835310	141433838	Mouse
14696689	Gdq2_m	grooming duration QTL 2, females (mouse)					4	100857197	124893793	Mouse
1300743	Skull6_m	skull morphology 6 (mouse)			Not determined		4	111009051	145009280	Mouse
1301382	Arvm2_m	autoimmune renal vasculitis 2 (mouse)			Not determined		4	107791564	141791756	Mouse
12910813	Pwbwq4_m	pre-weaning body weight QTL 4 (mouse)					4	105835310	141433838	Mouse
4141093	W3q17_m	weight 3 weeks QTL 17 (mouse)			Not determined			88982069	140468203	Mouse
12910808	Pwbwq9_m	post-weaning body weight QTL 9 (mouse)					4	105835310	141433838	Mouse
27095939	Ulnl9_m	ulna length 9, 16 week (mouse)					4	65318237	118857197	Mouse
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
4142493	Femwf13_m	femur work to failure 13 (mouse)			Not determined			116154678	150154782	Mouse
1301815	Sles2_m	systemic lupus erythmatosus suppressor 2 (mouse)			Not determined		4	94957579	150676858	Mouse
1300663	Start2_m	startle response 2 (mouse)			Not determined		4	107264957	141265153	Mouse
1300918	Stheal4_m	soft tissue heal 4 (mouse)			Not determined		4	89969627	123969747	Mouse
1301556	Cd4vts1_m	CD4 virgin T cell subset 1 (mouse)			Not determined		4	85428838	119429037	Mouse
1301823	Bmd7_m	bone mineral density 7 (mouse)			Not determined		4	88982069	151654550	Mouse
4141330	Iva1_m	isovaleric acid smelling 1 (mouse)			Not determined			117071971	120723203	Mouse
1302078	Sluc21_m	susceptibility to lung cancer 21 (mouse)			Not determined		4	117401141	151401275	Mouse
10412072	Ssen1_m	suseptibility to Sendai virus 1 (mouse)			Not determined		4	109658132	133154782	Mouse
1301930	Papg1_m	pulmonary adenoma progression 1 (mouse)			Not determined		4	85781167	119781279	Mouse
13208562	Wght7_m	weight 7 (mouse)					4	90888237	148084457	Mouse
13208565	Bmiq6_m	body mass index QTL 6 (mouse)					4	110857197	125893793	Mouse
1300655	Nidds_m	non-insulin-dependent diabetes mellitus in SJL (mouse)			Not determined		4	115030777	129465915	Mouse
1300781	Lith8_m	lithogenic gene 8 (mouse)			Not determined		4	107264957	141265153	Mouse
39128212	Lwq21_m	liver weight QTL 21 (mouse)					4	88982069	140468203	Mouse
1300689	Dob1_m	Dietary obesity 1 (mouse)			Body weight		4	101574601	123127211	Mouse
27226716	Metcl2_m	metatarsal-calcaneal length 2, 5 week (mouse)					4	88118237	118557197	Mouse
1301847	Fecq2_m	fecundity QTL 2 (mouse)			Not determined		4	100071971	134072206	Mouse
26884445	Sklq7_m	skull length QTL 7, 10 week (mouse)					4	68018237	150884457	Mouse
1301597	Anxty_m	anxiety (mouse)			Not determined		4	74137574	128009280	Mouse
26884437	Sklq13_m	skull length QTL 13, 16 week (mouse)					4	57700000	155684457	Mouse
4141549	W10q10_m	weight 10 weeks QTL 10 (mouse)			Not determined			88982069	140468203	Mouse
1357895	Ctrcts_m	cataract severity (mouse)			Not determined		4	45709925	138342753	Mouse
1300809	Ccrs2_m	corpus callosum hemisphere surface size 2 (mouse)			Not determined		4	107264957	141265153	Mouse
1301106	Skts7_m	skin tumor susceptibility 7 (mouse)			Not determined		4	100071971	134072206	Mouse
1301233	Sbw2_m	splenomegaly-NZB x NZW 2 (mouse)			Not determined		4	94957579	128009280	Mouse
10755520	Rbc1_m	red blood cell count 1 (mouse)					4	108477692	142477692	Mouse
10755521	Hct1_m	hematocrit 1 (mouse)					4	108477692	142477692	Mouse
10755522	Hgb1_m	hemoglobin 1 (mouse)					4	108477692	142477692	Mouse
27095924	Pglq2_m	pelvic girdle length QTL 2, 5 week (mouse)					4	69118237	130727311	Mouse
1301118	Bbaa23_m	B.burgdorferi-associated arthritis 23 (mouse)			Not determined		4	85781167	119781279	Mouse
15039368	Nmrs19_m	NAFLD-associated magnetic resonance shift 19 (mouse)					4	90882780	124882780	Mouse
27095917	Scvln14_m	sacral vertebrae length 2, 16 week (mouse)					4	68018237	130277062	Mouse
1301731	Cafq2_m	caffeine metabolism QTL 2 (mouse)			Not determined		4	94732255	128732454	Mouse
4141900	Skts-fp1_m	skin tumor susceptibility in FVB and PWK 1 (mouse)			Not determined		4	53550839	124055180	Mouse
15039382	Ltgq7_m	liver triglyceride QTL 7 (mouse)					4	105705794	139705794	Mouse
15039377	Bw45_m	body weight QTL 45 (mouse)					4	105705794	139705794	Mouse
1300839	Dyscalc2_m	dystrophic cardiac calcinosis 2 (mouse)			Not determined		4	111009051	145009280	Mouse
12880433	Fgf23lq1_m	FGF23 serum level QTL 1 (mouse)					4	101157197	135157197	Mouse
4141001	Tgq17_m	triglyceride QTL 17 (mouse)			Not determined			112523489	146523489	Mouse
1300580	Lbw2_m	lupus NZB x NZW 2 (mouse)			Not determined		4	98545539	128009280	Mouse
15039378	Adip30_m	adiposity 30 (mouse)					4	105705794	139705794	Mouse
26884449	Sklq2_m	skull length QTL 2, 5 week (mouse)					4	36700000	128993793	Mouse
27095905	Scvln3_m	sacral vertebrae length 2, 5 week (mouse)					4	55600000	128993793	Mouse
1357800	Tgq3_m	triglyceride QTL 3 (mouse)			Not determined		4	107055093	141055180	Mouse
15039385	Mvlq3_m	macrovesicular liver lesion QTL 3 (mouse)					4	112182386	146182386	Mouse
11553870	Cmmm_m	carcinoma modifier of MSM (mouse)					4	90590668	124590781	Mouse
1301996	Mmtg2_m	modifier of mammary tumor growth 2 (mouse)			Not determined		4	116270979	124055180	Mouse

AI467389

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	117,889,297 - 117,889,481	UniSTS	GRCm38
MGSCv37	4	117,561,902 - 117,562,086	UniSTS	GRCm37
Celera	4	116,604,464 - 116,604,648	UniSTS
Cytogenetic Map	4	D2.1	UniSTS
Whitehead/MRC_RH	4	1554.93	UniSTS

UniSTS:235012

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	117,889,178 - 117,889,385	UniSTS	GRCm38
MGSCv37	4	117,561,783 - 117,561,990	UniSTS	GRCm37
Celera	4	116,604,345 - 116,604,552	UniSTS
Cytogenetic Map	4	D2.1	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001419161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_026344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK011199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK018638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK051026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK080747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK194858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK207097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK218933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL627128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC014746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC031124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000030265 ⟹ ENSMUSP00000030265

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	117,745,840 - 117,749,229 (-)	Ensembl
GRCm38.p6 Ensembl	4	117,888,643 - 117,892,032 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000126554

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	117,748,275 - 117,749,183 (-)	Ensembl
GRCm38.p6 Ensembl	4	117,891,078 - 117,891,986 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000139332

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	117,746,104 - 117,749,217 (-)	Ensembl
GRCm38.p6 Ensembl	4	117,888,907 - 117,892,020 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000183773 ⟹ ENSMUSP00000138948

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	117,746,113 - 117,749,220 (-)	Ensembl
GRCm38.p6 Ensembl	4	117,888,916 - 117,892,023 (-)	Ensembl

RefSeq Acc Id:

NM_001419161 ⟹ NP_001406090

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	117,745,838 - 117,749,220 (-)	NCBI

RefSeq Acc Id:

NM_026344 ⟹ NP_080620

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	117,745,838 - 117,749,220 (-)	NCBI
GRCm38	4	117,888,643 - 117,892,003 (-)	NCBI
MGSCv37	4	117,561,248 - 117,564,608 (-)	RGD
Celera	4	116,603,810 - 116,607,170 (-)	RGD
cM Map	4		ENTREZGENE

Sequence:

show sequence

GTGTAGTGGAGAGCCGGGAATTTGGAAGCGTACGGTTTGGATCCTAGGACCCGAGGACAGGTTGGTCCGGATCCACAAACAGAGCTGCTGTGACCTCGAGGACTTTTGAGGGTGCAGCTGCATCTCAC
CCCACCCAAGCTGCGCCCAATGGAGTCTACGTTCAGCAGCCCTGCGGAGGCAGCCCTGCAACGGGAGGCGGGCGTTCCAGGACAGTTCACTCCTCCTGAAGACCTGGACCGCGTGTATGAGCTGGAGC
GAGTTACGAAATTTGTCTGCGATTTAGGTTGTCAGCGGGTGACTTTGCAGTTCCCTGACCAGTTACTAGGAGATGCGGGAGCGGTGGCTGCCCGGCTGGAGGAAGTCACAGGAGCTAAGATGTTCATT
TTAGGGGACACAGCTTATGGCAGCTGCTGTGTGGATGTGCTGGGCGCCGAGCAGGCTGGAGCTCAAGCCCTTGTGCACTTCGGTCCTGCCTGCTTAAGCCCCCCAGCCTCGCAGCTGCCCATCACCTT
TGTCCTTGGTCAGCGACCCGTTGCTTTAGAGCTCTGTGCAAAGGCCTTTGAAGCCCAGAACCCAGATCCGACAGCCCCGGTGGTACTGCTGAGTGAGCCAGCTTGTGCCCATGCCCTAGAGCCTTTGG
CCATGCTCCTGCTCCCAAAGTACCAAGATCTGCTCATCTCCCGCCCAGCTCTTCCCCTGCCAGTGGGATCCCCGAGCTCACAGCCTGAGTCCCTGGAGCGTTTTGGGCGCTGCTTCCCCCTGAATCCA
GGGAGACGTCTGGAAGAATATGGTGCCTTCTATGTAGGGGCTTCTCAAGCAAGCTCGGACTCCAGCCTTGATCCCGACCTGAGCAGACTGCTCTTGGGTTGGACACCAGGGCGGCCCTTCTTTTCCTG
TTGTCCAGATACAGGACAGACACAAGACCAGGGTGCCAAGGCTGGGAGACTAAGAGCACGAAGACTGTATCTCATAGAGAGGGCCAGAGATGCCCGTGTGGTTGGGCTGCTGGCAGGCACATTAGGTG
TGGCTCGACACCGTGAGGCACTGGCACACTTGCGGAAACTGACGGAAGCTGCTGGAAAACGTAGCTATGTGTTAGCCGTGGGGAAGCCCACACCCGCCAAGCTTGCCAACTTCCCTGAGATGGACGTC
TTTGTGCTGTTAGCCTGTCCCCTGGGGGCACTAGCCCCCCAGCCTTCGGGTGGCTTCTTTCGGCCTGTATTGACGCCATGTGAATTGGAGGCTGCCTGCAACCCTGCCTGGCCCCCGCCAGGCCTGGC
TCCCCACCTCACACATTATGCAGAGCTGTTGCCTGGTTCTCCCTTCCATGTGCCACTCCCTCCACCTGAGTCAGAGTTGTGGGATACCCCAGATGTGTCACTCATTTCTGGGGAGCTCCGACCACCAC
CTCCTTGGAAGTCATCAGATGACACTAGATGTTCGGCCTTAATTCCGAGGCCCCAACTGGAGCTGGCGGAGAGCAGCCCTGCAGCTTCATTCCTTAGTTCTCGGAACTGGCAGGGGCTGGAGCCACGC
TTGGGCCAGACACCAGTGAAAGAAGCCGTCAGAGGAAGACGAGGTATCGCCATCGCCTACGAGGATGAGGGGAGCAGCTGATACCTTGGGAGGCCAGAGCCAGAGTGATAAGTCTGCCGGGACCTGTT
CTCCCTGACCAACGTCTCGTCCTGTCACAGGGACACTTGATGCCTAGACACAGGGAGTGTAGGTAGCTCTCTCTGTGGAGCTGTCCAGCTTATAGCCTGTGCAGGGAGGGGTCCCAGGGCTCATCCCA
GTTCCTGGTGTGCAGGAGTTCTGCCCTTGGTCAGGGGCAGAAGTTGGATGATCCAGACCAGAGTTCTTCCACCTCCCTCAGCACTGTTGACAGTTTGGGCAGAGTAATTCTTTAATGCAGAGGCTACT
CTATATAGAGAAGGATGTATAGGTTCAGCTGACAGAAACAGAAACACCTCCCTTCCTCCCCAACTGAGCTAGGATAACCCAGATTATCTCTACAGGTTGGCAGATGTCATGTAACTACTCCTCATTGA
GAGCCTCTGGTCTAAACCTGCACTGTCCAAGACAATATTCACTGGACACATGACTTTTGCCATTTAAAGTGGATGAAAAAGTATTTGTCCATTACACTAATTACATTTCAAGCACTTATGTGGCTGCT
TTCAGGACTTTGTTGGGCTACATTGACTTAGTTAGACTTGTTTCTTGGGGACAACAAAGACACTGAAATAAACGGAATACTTTTTCTCCTGTTTCTCTTTATTCACTAAAGCTCTGTTCTACACAGAT
CCTGTGGGTGGATATGTGAGTTATATTTAACCAGATTACTGTCCTCAAAATGTGCTTGGGAGGAAATAATAACCCCACGAAATATAATTGTGTGAAGGGAGCCCCAGGTGCAGCTGGCTCTCATAGCA
GGCTCCTGAAGGGGACTCAAGAGGCAACCCAGACAGAGGAGTCTTAAGCTGGATCTTATAGAGAAAAAATATTCAGAATAAACAGAGTGAAACG

hide sequence


Protein RefSeqs	NP_001406090	(Get FASTA)	NCBI Sequence Viewer
	NP_080620	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH31124	(Get FASTA)	NCBI Sequence Viewer
	BAB27462	(Get FASTA)	NCBI Sequence Viewer
	BAB31322	(Get FASTA)	NCBI Sequence Viewer
	EDL30532	(Get FASTA)	NCBI Sequence Viewer
	EDL30533	(Get FASTA)	NCBI Sequence Viewer
	EDL30534	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000030265
	ENSMUSP00000030265.4
GenBank Protein	Q9CR25	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_080620 ⟸ NM_026344
- Peptide Label:	isoform 1
- UniProtKB:	Q8K0L8 (UniProtKB/Swiss-Prot), Q9CR25 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MESTFSSPAEAALQREAGVPGQFTPPEDLDRVYELERVTKFVCDLGCQRVTLQFPDQLLGDAGAVAARLEEVTGAKMFILGDTAYGSCCVDVLGAEQAGAQALVHFGPACLSPPASQLPITFVLGQRP VALELCAKAFEAQNPDPTAPVVLLSEPACAHALEPLAMLLLPKYQDLLISRPALPLPVGSPSSQPESLERFGRCFPLNPGRRLEEYGAFYVGASQASSDSSLDPDLSRLLLGWTPGRPFFSCCPDTGQ TQDQGAKAGRLRARRLYLIERARDARVVGLLAGTLGVARHREALAHLRKLTEAAGKRSYVLAVGKPTPAKLANFPEMDVFVLLACPLGALAPQPSGGFFRPVLTPCELEAACNPAWPPPGLAPHLTHY AELLPGSPFHVPLPPPESELWDTPDVSLISGELRPPPPWKSSDDTRCSALIPRPQLELAESSPAASFLSSRNWQGLEPRLGQTPVKEAVRGRRGIAIAYEDEGSS hide sequence

Ensembl Acc Id:

ENSMUSP00000138948 ⟸ ENSMUST00000183773

Ensembl Acc Id:

ENSMUSP00000030265 ⟸ ENSMUST00000030265

RefSeq Acc Id:	NP_001406090 ⟸ NM_001419161
- Peptide Label:	isoform 2

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9CR25-F1-model_v2	AlphaFold	Q9CR25	1-489	view protein structure

RGD ID:

6835161

Promoter ID:

MM_KWN:39269

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Liver, Lung, MEF_B4, MEF_B6

Transcripts:

OTTMUST00000019601, OTTMUST00000019602, OTTMUST00000019603, UC008UJE.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	4	117,564,501 - 117,565,432 (-)	MPROMDB

RGD ID:

6884388

Promoter ID:

EPDNEW_M5645

Type:

multiple initiation site

Name:

Dph2_1

Description:

Mus musculus DPH2 homolog , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	4	117,892,023 - 117,892,083	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000028540	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000030265	ENTREZGENE
	ENSMUST00000030265.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.11840	UniProtKB/Swiss-Prot
	3.40.50.11860	UniProtKB/Swiss-Prot
InterPro	DHP2	UniProtKB/Swiss-Prot
	DPH1/DPH2	UniProtKB/Swiss-Prot
	DPH1/DPH2_1	UniProtKB/Swiss-Prot
	DPH1/DPH2_3	UniProtKB/Swiss-Prot
KEGG Report	mmu:67728	UniProtKB/Swiss-Prot
MGD	MGI:1914978	ENTREZGENE
NCBI Gene	67728	ENTREZGENE
PANTHER	PTHR10762	UniProtKB/Swiss-Prot
	PTHR10762:SF2	UniProtKB/Swiss-Prot
Pfam	Diphthamide_syn	UniProtKB/Swiss-Prot
PhenoGen	Dph2	PhenoGen
UniProt	DPH2_MOUSE	UniProtKB/Swiss-Prot
	Q8K0L8	ENTREZGENE
	Q9CR25	ENTREZGENE
	V9GX25_MOUSE	UniProtKB/TrEMBL
UniProt Secondary	Q8K0L8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-29	Dph2	DPH2 homolog		DPH2 homolog (S. cerevisiae)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Mammalian Phenotype