Advanced Search (OLGA)

Gene: Ccdc182 (coiled-coil domain containing 182) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Ccdc182

Name:

coiled-coil domain containing 182

RGD ID:

1623143

MGI Page

MGI

Description:

Involved in female gonad development. Is expressed in central nervous system and genitourinary system. Orthologous to human CCDC182 (coiled-coil domain containing 182).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1700106J16Rik; coiled-coil domain-containing protein 182; coiled-coil domain-containing protein ENSP00000299415 homolog; novel tropomyosin domain containing protein; RP24-402O2.1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	88,184,869 - 88,186,087 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	88,184,884 - 88,186,087 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	88,294,043 - 88,295,261 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	88,294,058 - 88,295,261 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	88,107,545 - 88,108,763 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	88,107,910 - 88,111,456 (+)	NCBI		MGSCv36	mm8
Celera	11	97,899,335 - 97,900,551 (+)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	52.4	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc182	Mouse	17beta-estradiol	multiple interactions	ISO	Ccdc182 (Rattus norvegicus)	6480464	[bisphenol A co-treated with Estradiol] results in increased expression of CCDC182 mRNA	CTD	PMID:26496021
Ccdc182	Mouse	bisphenol A	multiple interactions	ISO	Ccdc182 (Rattus norvegicus)	6480464	[bisphenol A co-treated with Estradiol] results in increased expression of CCDC182 mRNA	CTD	PMID:26496021
Ccdc182	Mouse	crocidolite asbestos	increases expression	EXP		6480464	Asbestos and Crocidolite results in increased expression of CCDC182 mRNA	CTD	PMID:19446018
Ccdc182	Mouse	methoxychlor	affects methylation	ISO	Ccdc182 (Rattus norvegicus)	6480464	Methoxychlor affects the methylation of CCDC182 gene	CTD	PMID:35440735
Ccdc182	Mouse	titanium dioxide	decreases expression	EXP		6480464	titanium dioxide results in decreased expression of CCDC182 mRNA	CTD	PMID:29264374

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc182	Mouse	biological_process	involved_in	ND		2290270		MGI	GO_REF:0000015
Ccdc182	Mouse	female gonad development	involved_in	IEP		2290270	PMID:19301398	UniProt	PMID:19301398

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc182	Mouse	cellular_component	is_active_in	ND		2290270		MGI	GO_REF:0000015

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ccdc182	Mouse	molecular_function	enables	ND		2290270		MGI	GO_REF:0000015

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:16141072	PMID:16141073	PMID:18287559	PMID:19301398	PMID:19334288	PMID:19501082	PMID:21267068
PMID:21386911	PMID:22496664

Ccdc182
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	88,184,869 - 88,186,087 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	88,184,884 - 88,186,087 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	88,294,043 - 88,295,261 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	88,294,058 - 88,295,261 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	88,107,545 - 88,108,763 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	88,107,910 - 88,111,456 (+)	NCBI		MGSCv36	mm8
Celera	11	97,899,335 - 97,900,551 (+)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	52.4	NCBI

CCDC182
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	57,744,495 - 57,745,299 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	57,744,495 - 57,745,299 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	55,821,856 - 55,822,660 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Cytogenetic Map	17	q22	NCBI
HuRef	17	51,182,433 - 51,183,300 (-)	NCBI		HuRef
CHM1_1	17	55,886,929 - 55,887,796 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	58,617,754 - 58,618,558 (-)	NCBI		T2T-CHM13v2.0

Ccdc182
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	73,587,416 - 73,588,228 (+)	NCBI		GRCr8
mRatBN7.2	10	73,090,228 - 73,091,040 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	73,090,194 - 73,091,433 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	77,702,565 - 77,703,377 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	77,207,497 - 77,208,309 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	72,670,675 - 72,671,487 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	75,619,867 - 75,621,629 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	75,620,470 - 75,621,258 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	74,487,684 - 74,488,345 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	76,608,459 - 76,608,917 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	71,999,562 - 72,000,374 (+)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

Ccdc182
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955451	5,216,761 - 5,218,204 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCDC182
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	73,918,794 - 73,919,813 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	78,729,696 - 78,730,715 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	51,822,901 - 51,823,865 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	56,680,726 - 56,681,562 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	56,681,050 - 56,681,511 (-)	Ensembl	panpan1.1		panPan2

CCDC182
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	32,461,336 - 32,462,643 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	32,461,679 - 32,462,140 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	31,700,254 - 31,701,456 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	33,269,419 - 33,270,621 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	33,269,762 - 33,270,223 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	32,054,167 - 32,055,369 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	32,337,332 - 32,338,534 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	32,421,248 - 32,422,450 (-)	NCBI		UU_Cfam_GSD_1.0

Ccdc182
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	31,800,927 - 31,802,676 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	5,272,477 - 5,272,938 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	5,272,477 - 5,272,938 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCDC182
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	34,032,263 - 34,032,724 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	34,032,263 - 34,032,793 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	34,747,677 - 34,748,564 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCDC182
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	35,647,441 - 35,649,171 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	35,648,374 - 35,648,832 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	6,466,271 - 6,467,085 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccdc182
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	12,654,943 - 12,655,404 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	12,650,108 - 12,655,759 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Predicted Target Of

	Summary Value
Count of predictions:	199
Count of miRNA genes:	162
Interacting mature miRNAs:	187
Transcripts:	ENSMUST00000037268
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
27226783	Tibl5_m	tibia length 5, 5 week (mouse)					11	68190826	101890826	Mouse
1300628	Lgth6_m	body length 6 (mouse)			Not determined		11	66733420	100733652	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44630038	113058009	Mouse
1558812	Rafar_m	retinoic acid induced forelimb autopod reduction (mouse)			Not determined		11	70691198	104691366	Mouse
1300766	Skull16_m	skull morphology 16 (mouse)			Not determined		11	81574481	115574636	Mouse
1301404	Sbmd4_m	spinal bone mineral density 4 (mouse)			Not determined		11	72019649	106019734	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56864027	114157957	Mouse
27226758	Femd3_m	femur midshaft diameter 3, 5 week (mouse)					11	80890826	101890826	Mouse
14747003	Mancz9_m	mandible centroid size 9 (mouse)					11	85844911	119844911	Mouse
1301640	Lore4_m	loss of righting induced by ethanol 4 (mouse)			Not determined		11	79156009	107616472	Mouse
10412288	Carg4_m	Candida albicans resistance gene 4 (mouse)			Not determined		11	81810267	115810267	Mouse
1357878	Mastr_m	modifier of astrocytoma (mouse)			Not determined		11	45708581	89818733	Mouse
1301681	Sle13_m	systematic lupus erythematosus susceptibility 13 (mouse)			Not determined		11	70691198	104691366	Mouse
1300784	Prdt3_m	prion disease incubation time 3 (mouse)			Not determined		11	66733420	100733652	Mouse
4141339	Nilac2_m	nicotine induced locomotor activity 2 (mouse)			Not determined		11	70691198	104691366	Mouse
10413882	Moe1_m	modifier of epilepsy 1 (mouse)					11	77770978	111771099	Mouse
11039501	Ltpr6a_m	Leishmania tropica response 6a (mouse)					11	64830336	98830473	Mouse
13208559	Wght10_m	weight 10 (mouse)					11	3950000	88890826	Mouse
11039502	Ltpr6b_m	Leishmania tropica response 6b (mouse)					11	64830336	98830473	Mouse
13208558	Lgth12_m	body length 12 (mouse)					11	3950000	94890826	Mouse
10045616	Heal25_m	wound healing/regeneration 25 (mouse)			Not determined		11	77437183	111437322	Mouse
1300664	Etohcta9_m	ethanol conditioned taste aversion 9 (mouse)			Not determined		11	57754660	91754758	Mouse
1357631	Motr1_m	modifier of tubby retinal degeneration 1 (mouse)			Not determined		11	87691198	103274115	Mouse
1301310	Tmevd5_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse)			Not determined		11	72726125	106726289	Mouse
11039515	Ltpr6_m	Leishmania tropica response 6 (mouse)					11	64830336	98830473	Mouse
4142348	Pstc2_m	periosteal circumference 2 (mouse)			Not determined		11	72818615	106818733	Mouse
1301414	Heal10_m	wound healing/regeneration 10 (mouse)			Not determined		11	77437183	111437322	Mouse
15092049	Wsigrme3_m	week six growth rate, maternal effect 3 (mouse)					11	84877324	96629512	Mouse
1300651	Pcyts3_m	plasmacytoma susceptibility 3 (mouse)			Not determined		11	70691198	104691366	Mouse
1301546	Pcir2_m	periosteal circumference 2 (mouse)			Not determined		11	66733420	100733652	Mouse
1300905	Scc6_m	colon tumor susceptibility 6 (mouse)			Not determined		11	6880277	89019734	Mouse
1300649	Crhq1_m	compensatory renal hypertrophy QTL 1 (mouse)			Not determined		11	81574481	115574636	Mouse
27226789	Feml16_m	femur length 16, 10 week (mouse)					11	87490826	121873369	Mouse
14746970	Manh71_m	mandible shape 71 (mouse)					11	79416257	113416257	Mouse
15092057	Lgrme3_m	late growth rate, maternal effect 3 (mouse)					11	84877324	96629512	Mouse
10043865	T2dm5sa_m	type 2 diabetes mellitus 5 in SMXA RI mice (mouse)			Not determined		11	79813759	104502698	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
10043866	Adip19_m	adiposity 19 (mouse)			Not determined		11	72818615	106818733	Mouse
1301072	Eae22_m	experimental allergic encephalomyelitis 22 (mouse)			Not determined		11	82377698	116377820	Mouse
10412246	Dfs2_m	dental fluorosis suseptibility 2 (mouse)			Not determined		11	21807364	95881231	Mouse
11038695	Par8_m	pulmonary adenoma resistance 8 (mouse)					11	77063779	111063918	Mouse
1357766	Si5lq6_m	serum IGFBP-5 level QTL 6 (mouse)			Not determined		11	66733420	100733652	Mouse
1301319	Dautb4_m	dopamine uptake transporter binding 4 (mouse)			Not determined		11	62156005	96156153	Mouse
1301833	Tbbmd5_m	total body bone mineral density 5 (mouse)			Not determined		11	66733420	100733652	Mouse
15014785	Mvlq1_m	macrovesicular liver lesion QTL 1 (mouse)					11	86608320	120608320	Mouse
4141012	Femwf6_m	femur work to failure 6 (mouse)			Not determined			66733420	100733652	Mouse
15039374	Adip29_m	adiposity 29 (mouse)					11	86608320	120608320	Mouse
1301987	Pid3_m	prior incubation determinant 3 (mouse)			Not determined		11	61686820	88699728	Mouse
27226730	Tibmd1_m	tibia midshaft diameter 1, 5 week (mouse)					11	62590826	109390826	Mouse
15039376	Bw42_m	body weight QTL 42 (mouse)					11	86608320	120608320	Mouse
4141894	Nidd6k_m	Nidd6 on KK-A (mouse)			Not determined			19124204	96897826	Mouse
10044004	Stzid3_m	streptozotocin induced diabetes susceptibility 3 (mouse)			Not determined		11	63319407	94063918	Mouse
10044007	Hbnr14_m	Heligmosomoides bakeri nematode resistance 14 (mouse)			Not determined		11	87502600	121502698	Mouse
1302124	Eae7_m	susceptibility to experimental allergic encephalomyelitis 7 (mouse)			Not determined		11	77573873	99377820	Mouse

1700106J16Rik

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	88,294,065 - 88,294,694	UniSTS	GRCm38
MGSCv37	11	88,107,567 - 88,108,196	UniSTS	GRCm37
Celera	11	97,899,357 - 97,899,986	UniSTS
Cytogenetic Map	11	C	UniSTS
cM Map	11		UniSTS

1700106J16Rik

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	88,294,116 - 88,294,218	UniSTS	GRCm38
MGSCv37	11	88,107,618 - 88,107,720	UniSTS	GRCm37
Celera	11	97,899,408 - 97,899,510	UniSTS
Cytogenetic Map	11	C	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_028859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK007129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK137123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL929089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU442701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000037268 ⟹ ENSMUSP00000036503

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	88,184,884 - 88,186,087 (+)	Ensembl
GRCm38.p6 Ensembl	11	88,294,058 - 88,295,261 (+)	Ensembl

RefSeq Acc Id:

NM_028859 ⟹ NP_083135

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	88,184,869 - 88,186,087 (+)	NCBI
GRCm38	11	88,294,043 - 88,295,261 (+)	ENTREZGENE
MGSCv37	11	88,107,545 - 88,108,763 (+)	RGD
Celera	11	97,899,335 - 97,900,551 (+)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

AGCTCCCAAATCTCTGACTCAGTTTCTTGGCTTCCTCTCTGCAGAAGGAGATAATGGAAGCCCTCTTTCAGGCAGGGTCCATTCTTATGAAGGTGAATACCTTACAGGGCAAGAAGATGGTGGAAAGC
GGGCTCCAGTCTGGGGACCTTTCCCTGTCTCAGTCATGGCCCTCCTACCTCCCTCTGCCGGCCGACTTGGAGATCCTACAGCAGAAGGTGGCCGGGGTACAAAGGGAGTTGGAGGACTTCAAGGAGGA
GGCACTGAAGGCCATCCGTTACTTGGAGGACGCCTTCTGCCAGATGAGTGGCGTCCTGGCACAGCAGGAGGAGCAGGCGGCGCGAGTGAAGCAGCGGCTGAGGGAGGAGGAGGACCGAGGCATCGTCC
GCAACAAGGTCCTCACCTTCCTCCTGCCCCGGGAGAAGCAGCTTCGTGAACACTGCCAGCGGTTGGAGAACATGTTGGTCAGGAGCCACAACCCGCTGCGAGCCATCAGGAAGAGCCAGGCGGACTGA
GCGGCCCGCGCCCGAGTGTGCGCCCGAGCTGGCGGGCAAGATTGTTTTTTAATGGAAGGACAAACGCTAAGTCCCCATTTATTCCCCTTGCCCCATTTTTATTGCTTTCCTGCTACCAAAATAACACC
ATGCAGAGAGGCAAAAAAGACCTCAATATGGTTTTCGGGTGAAGTTCCGTTTATCCAGCCTCGTCAAGGAAGGAGGCCCCAGACACTATGTCAGACCTGTAACCATCCCCTCGAACTGTTTCCCGTTT
GTAATGGTACGGTTGCTTGGATGTAGGGGCATTTTTCTTGAGTATTCTTAAACTGGTTGTGTTGAACAGATTTAACCTTTCTTTTAATGACTCCAGGCTTTCGTGATTTATCACTTCACAATTGGTTT
CCTGAGACCTGTCAGTGTGTGTTCTATACCGAGACAGGTTGGGGGCTTAGTGAGAGAGAGGGCTTGCCCGCATCCTGAACTGGACTCAGACGGCCGGCTTTGTGTAATTCCTGACCTCGCCGTTTCAG
TCTGCTTGCATAGTTGGACTATTGGTCCTCTCTTTTCCTTACTGCTTTGGTTCAACTCTGCTTCCTCTCCATTTACCCCGAAGACAGGCTGCTCCGTGGGGTGAACCTTGTTAGGTTTCTGATGGTGG
AACTCTCGGCTCGCCACTGCACTCAAGGTGACATCTATAAGTTCGCACAATAAAACAGTGAAACTGA

hide sequence


Protein RefSeqs	NP_083135	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB24866	(Get FASTA)	NCBI Sequence Viewer
	EDL15845	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000036503
	ENSMUSP00000036503.5
GenBank Protein	Q9D9C6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_083135 ⟸ NM_028859
- UniProtKB:	Q9D9C6 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MEALFQAGSILMKVNTLQGKKMVESGLQSGDLSLSQSWPSYLPLPADLEILQQKVAGVQRELEDFKEEALKAIRYLEDAFCQMSGVLAQQEEQAARVKQRLREEEDRGIVRNKVLTFLLPREKQLREH CQRLENMLVRSHNPLRAIRKSQAD hide sequence

Ensembl Acc Id:

ENSMUSP00000036503 ⟸ ENSMUST00000037268

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9D9C6-F1-model_v2	AlphaFold	Q9D9C6	1-152	view protein structure

RGD ID:

8676104

Promoter ID:

EPDNEW_M16082

Type:

multiple initiation site

Name:

Ccdc182_1

Description:

Mus musculus coiled-coil domain containing 182 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	88,294,058 - 88,294,118	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000034031	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000037268	ENTREZGENE
	ENSMUST00000037268.6	UniProtKB/Swiss-Prot
InterPro	DUF4715	UniProtKB/Swiss-Prot
KEGG Report	mmu:74297	UniProtKB/Swiss-Prot
MGD	MGI:1921547	ENTREZGENE
NCBI Gene	74297	ENTREZGENE
PANTHER	COILED-COIL DOMAIN-CONTAINING PROTEIN 182	UniProtKB/Swiss-Prot
	PTHR37364	UniProtKB/Swiss-Prot
Pfam	DUF4715	UniProtKB/Swiss-Prot
PhenoGen	Ccdc182	PhenoGen
UniProt	CC182_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-18	Ccdc182	coiled-coil domain containing 182	1700106J16Rik	RIKEN cDNA 1700106J16 gene	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message