Symbol:
Stimate
Name:
STIM activating enhancer
RGD ID:
1622297
MGI Page
MGI
Description:
Predicted to enable calcium channel regulator activity. Predicted to be involved in activation of store-operated calcium channel activity and store-operated calcium entry. Predicted to be located in endoplasmic reticulum membrane and endoplasmic reticulum-plasma membrane contact site. Predicted to be active in cortical endoplasmic reticulum and membrane. Is expressed in genitourinary system; heart; lung; spleen; and stomach. Orthologous to human STIMATE (STIM activating enhancer).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1810038N08Rik; 2310014H19Rik; AW554125; RIKEN cDNA 2310014H19 gene; STIM-activating enhancer encoded by TMEM110; store-operated calcium entry regulator STIMATE; Tmem110; transmembrane protein 110
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
STIMATE (STIM activating enhancer) HGNC
Ensembl, HGNC, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Stimate (STIM activating enhancer) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
STIMATE (STIM activating enhancer) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Stimate (STIM activating enhancer) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
STIMATE (STIM activating enhancer) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
STIMATE (STIM activating enhancer) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
STIMATE-MUSTN1 (STIMATE-MUSTN1 readthrough) HGNC
EggNOG, HomoloGene, OMA, OrthoDB, OrthoMCL, Treefam
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Stimate (STIM activating enhancer)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
STIMATE (STIM activating enhancer)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
STIMATE-MUSTN1 (STIMATE-MUSTN1 readthrough)
Alliance
DIOPT (HGNC)
Saccharomyces cerevisiae (baker's yeast):
YPL162C
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
stimate
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
stimate
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
tmem110l
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 30,547,533 - 30,599,167 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 30,547,547 - 30,599,167 (+) Ensembl GRCm39 Ensembl GRCm38 14 30,825,575 - 30,877,210 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 30,825,590 - 30,877,210 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 31,638,780 - 31,690,396 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 29,654,625 - 29,705,995 (+) NCBI MGSCv36 mm8 Celera 14 27,082,598 - 27,134,580 (+) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 19.09 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Stimate Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of STIMATE mRNA CTD PMID:22206623 Stimate Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of STIMATE mRNA CTD PMID:20702594|PMID:21570461|PMID:26377647 Stimate Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of STIMATE mRNA CTD PMID:26290441 Stimate Mouse 2,3,7,8-Tetrachlorodibenzofuran affects expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran affects the expression of STIMATE mRNA CTD PMID:20702594 Stimate Mouse 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of STIMATE exon CTD PMID:33297965 Stimate Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of STIMATE gene CTD PMID:31683443 Stimate Mouse acrylamide decreases expression ISO RGD:1602041 6480464 Acrylamide results in decreased expression of STIMATE mRNA CTD PMID:32763439 Stimate Mouse aflatoxin B1 increases methylation ISO RGD:1602041 6480464 Aflatoxin B1 results in increased methylation of STIMATE gene; Aflatoxin B1 results in increased methylation more ... CTD PMID:27153756|PMID:30157460 Stimate Mouse antirheumatic drug increases expression ISO RGD:1602041 6480464 Antirheumatic Agents results in increased expression of STIMATE mRNA CTD PMID:24449571 Stimate Mouse arsane multiple interactions ISO RGD:1602041 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Stimate Mouse arsenic atom multiple interactions ISO RGD:1602041 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Stimate Mouse benzo[a]pyrene decreases expression ISO RGD:1602041 6480464 Benzo(a)pyrene results in decreased expression of STIMATE mRNA CTD PMID:32234424 Stimate Mouse benzo[a]pyrene increases methylation ISO RGD:1602041 6480464 Benzo(a)pyrene results in increased methylation of STIMATE promoter CTD PMID:27901495 Stimate Mouse bisphenol A decreases methylation ISO RGD:1602041 6480464 bisphenol A results in decreased methylation of STIMATE gene CTD PMID:31601247 Stimate Mouse carbamazepine affects expression ISO RGD:1602041 6480464 Carbamazepine affects the expression of STIMATE mRNA CTD PMID:25979313 Stimate Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon analog results in decreased expression of STIMATE mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Stimate Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of STIMATE mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25620056 Stimate Mouse CGP 52608 multiple interactions ISO RGD:1602041 6480464 CGP 52608 promotes the reaction [RORA protein binds to STIMATE gene] CTD PMID:28238834 Stimate Mouse cyclosporin A decreases expression ISO RGD:1602041 6480464 Cyclosporine results in decreased expression of STIMATE mRNA CTD PMID:20106945 Stimate Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of STIMATE mRNA CTD PMID:34813904 Stimate Mouse fulvestrant increases methylation ISO RGD:1602041 6480464 Fulvestrant results in increased methylation of STIMATE gene CTD PMID:31601247 Stimate Mouse hypochlorous acid decreases expression EXP 6480464 Hypochlorous Acid results in decreased expression of STIMATE mRNA CTD PMID:19376150 Stimate Mouse manganese atom multiple interactions ISO RGD:1602041 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Stimate Mouse manganese(0) multiple interactions ISO RGD:1602041 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Stimate Mouse manganese(II) chloride multiple interactions ISO RGD:1602041 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Stimate Mouse niclosamide decreases expression ISO RGD:1602041 6480464 Niclosamide results in decreased expression of STIMATE mRNA CTD PMID:36318118 Stimate Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Stimate Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of STIMATE mRNA CTD PMID:17562736 Stimate Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Stimate Mouse propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of STIMATE mRNA CTD PMID:21278054 Stimate Mouse sodium arsenite multiple interactions ISO RGD:1602041 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Stimate Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of STIMATE promoter CTD PMID:35295148 Stimate Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of STIMATE promoter CTD PMID:35295148 Stimate Mouse valproic acid affects expression ISO RGD:1602041 6480464 Valproic Acid affects the expression of STIMATE mRNA CTD PMID:25979313
Stimate Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 30,547,533 - 30,599,167 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 30,547,547 - 30,599,167 (+) Ensembl GRCm39 Ensembl GRCm38 14 30,825,575 - 30,877,210 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 30,825,590 - 30,877,210 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 31,638,780 - 31,690,396 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 29,654,625 - 29,705,995 (+) NCBI MGSCv36 mm8 Celera 14 27,082,598 - 27,134,580 (+) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 19.09 NCBI
STIMATE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 52,836,733 - 52,897,548 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 52,836,219 - 52,897,548 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 52,870,749 - 52,931,564 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 52,848,938 - 52,906,587 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 52,852,699 - 52,910,364 (-) NCBI Celera Cytogenetic Map 3 p21.1 NCBI HuRef 3 52,932,580 - 52,993,335 (-) NCBI HuRef CHM1_1 3 52,822,972 - 52,883,786 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 52,869,752 - 52,930,551 (-) NCBI T2T-CHM13v2.0
Stimate Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955430 2,794,324 - 2,848,617 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955430 2,794,324 - 2,848,619 (-) NCBI ChiLan1.0 ChiLan1.0
STIMATE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 52,831,558 - 52,892,410 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 52,836,327 - 52,897,165 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 52,778,459 - 52,839,273 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 54,004,187 - 54,064,500 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 54,004,187 - 54,065,422 (-) Ensembl panpan1.1 panPan2
Stimate Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 170,457,096 - 170,509,387 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936473 3,595,299 - 3,648,014 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936473 3,595,669 - 3,647,971 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
STIMATE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 34,949,577 - 35,017,827 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 34,946,260 - 35,017,817 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 38,125,600 - 38,195,116 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STIMATE
.
Predicted Target Of
Count of predictions: 1545 Count of miRNA genes: 669 Interacting mature miRNAs: 861 Transcripts: ENSMUST00000006701, ENSMUST00000164004, ENSMUST00000164184, ENSMUST00000164482, ENSMUST00000171920 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357589 Kdnw2_m kidney weight 2 (mouse) Not determined 14 20887473 121269804 Mouse 27226748 Femd8_m femur midshaft diameter 8, 10 week (mouse) 14 13769273 46737457 Mouse 1357527 Epfpq1_m epididymal fat percentage QTL 1 (mouse) Not determined 14 21062450 71885801 Mouse 27226744 Metcl6_m metatarsal-calcaneal length 6, 5 week (mouse) 14 30321957 52937457 Mouse 27226775 Tibl7_m tibia length 7, 5 week (mouse) 14 30321957 48837457 Mouse 27226774 Tibl15_m tibia length 15, 10 week (mouse) 14 30321957 87937436 Mouse 4142485 Modor2_m modifier of ocular retardation 2 (mouse) Not determined 14 24926248 58179769 Mouse 1301372 Sluc13_m susceptibility to lung cancer 13 (mouse) Not determined 14 18827604 52827726 Mouse 4141550 Dbm3_m diabetes modifier 3 (mouse) Not determined 5143473 39143596 Mouse 1300544 Hypn_m hyperinsulinemia (mouse) Not determined 14 15160616 49160765 Mouse 1301991 Wta3_m weight adult 3 (mouse) Not determined 14 3887473 37887650 Mouse 1300998 Cia17_m collagen induced arthritis 17 (mouse) Not determined 14 30335250 64335381 Mouse 4141864 Mrdq4_m modifier of retinal degeneration QTL 4 (mouse) Not determined 9923245 48765082 Mouse 10043886 Cia49_m collagen induced arthritis QTL 49 (mouse) Not determined 14 29996994 63997133 Mouse 1300779 Dyscalc4_m dystrophic cardiac calcinosis 4 (mouse) Not determined 14 12212871 46213007 Mouse 14746973 Manh76_m mandible shape 76 (mouse) 14 22287217 56287217 Mouse 1300909 Ath13_m atherosclerosis 13 (mouse) Not determined 14 30335250 64335381 Mouse 27226752 Femd4_m femur midshaft diameter 4, 5 week (mouse) 14 13769273 47237457 Mouse 13506929 Recrq10_m recombination rate in male meiosis QTL 10 (mouse) 14 27921957 61137449 Mouse
AW554125
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 30,876,634 - 30,876,781 UniSTS GRCm38 MGSCv37 14 31,689,820 - 31,689,967 UniSTS GRCm37 Celera 14 27,134,007 - 27,134,154 UniSTS Cytogenetic Map 14 B UniSTS Whitehead/MRC_RH 14 233.29 UniSTS
UniSTS:237152
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 30,876,470 - 30,876,691 UniSTS GRCm38 MGSCv37 14 31,689,656 - 31,689,877 UniSTS GRCm37 Celera 14 27,133,843 - 27,134,064 UniSTS Cytogenetic Map 14 B UniSTS
UniSTS:224289
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 14 30,832,390 - 30,832,542 UniSTS GRCm38 MGSCv37 14 31,645,576 - 31,645,728 UniSTS GRCm37 Celera 14 27,089,393 - 27,089,545 UniSTS Cytogenetic Map 14 B UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000006701 ⟹ ENSMUSP00000006701
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 30,547,547 - 30,599,167 (+) Ensembl GRCm38.p6 Ensembl 14 30,825,590 - 30,877,210 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000226788
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 30,594,312 - 30,596,957 (+) Ensembl GRCm38.p6 Ensembl 14 30,872,355 - 30,875,000 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000227246 ⟹ ENSMUSP00000154178
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 30,547,547 - 30,599,167 (+) Ensembl GRCm38.p6 Ensembl 14 30,825,590 - 30,877,210 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000227776
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 30,588,402 - 30,596,921 (+) Ensembl GRCm38.p6 Ensembl 14 30,866,445 - 30,874,964 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000228046
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 30,592,469 - 30,594,509 (+) Ensembl GRCm38.p6 Ensembl 14 30,870,512 - 30,872,552 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000228066 ⟹ ENSMUSP00000154699
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 30,547,551 - 30,596,527 (+) Ensembl GRCm38.p6 Ensembl 14 30,825,594 - 30,874,570 (+) Ensembl
RefSeq Acc Id:
NM_028839 ⟹ NP_083115
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 30,547,551 - 30,599,167 (+) NCBI GRCm38 14 30,825,594 - 30,877,210 (+) ENTREZGENE MGSCv37 14 31,638,780 - 31,690,396 (+) RGD Celera 14 27,082,598 - 27,134,580 (+) RGD cM Map 14 ENTREZGENE
Sequence:
GTCGGGTTACGCGCGGCGCGGAGGCGGCCGCGGGCTGAGATACCGGCACCCAGCTCCAGGTCCGGGGTCGCGGCTGGGCAGCGCGACCCGGGCTGCAGCGAGGCCGGCGGCCCCTCGCGCCCTCCCGT
hide sequence
RefSeq Acc Id:
XM_030247992 ⟹ XP_030103852
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 30,547,533 - 30,599,167 (+) NCBI GRCm38 14 30,825,575 - 30,877,210 (+) NCBI
Sequence:
AGCTCTACGATCTCGGACGTCGGGTTACGCGCGGCGCGGAGGCGGCCGCGGGCTGAGATACCGG
hide sequence
RefSeq Acc Id:
XM_036158839 ⟹ XP_036014732
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 30,547,533 - 30,599,167 (+) NCBI
Sequence:
AGCTCTACGATCTCGGACGTCGGGTTACGCGCGGCGCGGAGGCGGCCGCGGGCTGAGATACCGG
hide sequence
RefSeq Acc Id:
NP_083115 ⟸ NM_028839
- UniProtKB:
Q9D8S1 (UniProtKB/Swiss-Prot), Q9D7D4 (UniProtKB/Swiss-Prot), Q8R3U0 (UniProtKB/Swiss-Prot), Q8C691 (UniProtKB/Swiss-Prot), Q3UF25 (UniProtKB/Swiss-Prot), Q3U2J0 (UniProtKB/Swiss-Prot)
- Sequence:
MQGPGGNVSRGLPSGPASTVASGAGRCESGALMHSFGIFLQGLLGVVAFSTLMLKRFREPKHERRPWRIWFLDTSKQAIGMLFIHFANVYLADLTEEDPCSLYLINFLLDATVGMLLIYVGVRAVGVL
hide sequence
RefSeq Acc Id:
XP_030103852 ⟸ XM_030247992
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSMUSP00000006701 ⟸ ENSMUST00000006701
Ensembl Acc Id:
ENSMUSP00000154699 ⟸ ENSMUST00000228066
Ensembl Acc Id:
ENSMUSP00000154178 ⟸ ENSMUST00000227246
RefSeq Acc Id:
XP_036014732 ⟸ XM_036158839
- Peptide Label:
isoform X2
RGD ID: 8681782 Promoter ID: EPDNEW_M18922 Type: initiation region Name: Tmem110_1 Description: Mus musculus transmembrane protein 110 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 14 30,825,602 - 30,825,662 EPDNEW
RGD ID: 6825485 Promoter ID: MM_KWN:16071 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: NM_028839 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 31,638,111 - 31,639,112 (+) MPROMDB
RGD ID: 6847151 Promoter ID: MM_ACW:15456 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: TMEM110.ESEP07 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 31,682,646 - 31,683,146 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Stimate
STIM activating enhancer
2310014H19Rik
RIKEN cDNA 2310014H19 gene
Symbol and/or name change
5135510 APPROVED
2024-08-21
2310014H19Rik
RIKEN cDNA 2310014H19 gene
Stimate
STIM activating enhancer
Symbol and/or name change
5135510 APPROVED
2019-02-26
Stimate
STIM activating enhancer
Tmem110
transmembrane protein 110
Symbol and/or name change
5135510 APPROVED
