Symbol:
Gtdc1
Name:
glycosyltransferase-like domain containing 1
RGD ID:
1621335
MGI Page
MGI
Description:
Predicted to enable tRNA-queuosine(34) beta-mannosyltransferase activity. Predicted to be involved in regulation of translation and tRNA modification. Predicted to be located in nucleus. Predicted to be active in cytoplasm. Is expressed in central nervous system. Orthologous to human GTDC1 (glycosyltransferase like domain containing 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
E330008O22Rik; glycosyltransferase-like domain-containing protein 1; QTMAN; tRNA-queuosine alpha-mannosyltransferase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GTDC1 (glycosyltransferase like domain containing 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Gtdc1 (glycosyltransferase-like domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gtdc1 (glycosyltransferase like domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GTDC1 (glycosyltransferase like domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GTDC1 (glycosyltransferase like domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gtdc1 (glycosyltransferase like domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GTDC1 (glycosyltransferase like domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GTDC1 (glycosyltransferase like domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gtdc1 (glycosyltransferase like domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
GTDC1 (glycosyltransferase like domain containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Gtdc1 (glycosyltransferase-like domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gtdc1 (glycosyltransferase-like domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG15914
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gtdc1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 44,454,420 - 44,817,761 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 44,454,424 - 44,817,669 (-) Ensembl GRCm39 Ensembl GRCm38 2 44,564,412 - 44,927,717 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 44,564,412 - 44,927,657 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 44,419,942 - 44,717,142 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 44,386,431 - 44,683,631 (-) NCBI MGSCv36 mm8 Celera 2 46,279,991 - 46,577,581 (-) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 27.27 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gtdc1 Mouse (-)-alpha-phellandrene increases expression ISO GTDC1 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of GTDC1 mRNA CTD PMID:25075043 Gtdc1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GTDC1 mRNA CTD PMID:36331819 Gtdc1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of GTDC1 mRNA CTD PMID:22206623 Gtdc1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GTDC1 mRNA CTD PMID:21570461 Gtdc1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GTDC1 mRNA CTD PMID:32553695 Gtdc1 Mouse 2,4-diaminotoluene decreases expression EXP 6480464 2 and 4-diaminotoluene results in decreased expression of GTDC1 mRNA CTD PMID:20713471 Gtdc1 Mouse 6-propyl-2-thiouracil decreases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of GTDC1 mRNA CTD PMID:30047161 Gtdc1 Mouse 7,12-dimethyltetraphene decreases expression EXP 6480464 9 more ... CTD PMID:32553695 Gtdc1 Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of GTDC1 mRNA CTD PMID:19770486 Gtdc1 Mouse aflatoxin B1 decreases methylation ISO GTDC1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GTDC1 gene CTD PMID:27153756 Gtdc1 Mouse aflatoxin B1 decreases expression ISO GTDC1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of GTDC1 mRNA CTD PMID:21641981 and PMID:22100608 Gtdc1 Mouse aflatoxin M1 decreases expression ISO GTDC1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of GTDC1 mRNA CTD PMID:30928695 Gtdc1 Mouse alpha-phellandrene increases expression ISO GTDC1 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of GTDC1 mRNA CTD PMID:25075043 Gtdc1 Mouse amitrole decreases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of GTDC1 mRNA CTD PMID:30047161 Gtdc1 Mouse antirheumatic drug increases expression ISO GTDC1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of GTDC1 mRNA CTD PMID:24449571 Gtdc1 Mouse aristolochic acid A decreases expression ISO GTDC1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GTDC1 mRNA CTD PMID:33212167 Gtdc1 Mouse arsane multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GTDC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GTDC1 mRNA CTD PMID:39836092 Gtdc1 Mouse arsenic atom multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GTDC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GTDC1 mRNA CTD PMID:39836092 Gtdc1 Mouse arsenite(3-) multiple interactions ISO GTDC1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to GTDC1 mRNA] CTD PMID:32406909 Gtdc1 Mouse atrazine affects methylation ISO Gtdc1 (Rattus norvegicus) 6480464 Atrazine affects the methylation of GTDC1 gene CTD PMID:28931070 and PMID:35440735 Gtdc1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene metabolite results in decreased expression of GTDC1 mRNA and Benzo(a)pyrene results in decreased expression of GTDC1 mRNA CTD PMID:19770486 more ... Gtdc1 Mouse benzo[a]pyrene increases methylation ISO GTDC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GTDC1 5' UTR CTD PMID:27901495 Gtdc1 Mouse benzo[a]pyrene decreases expression ISO GTDC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GTDC1 mRNA CTD PMID:20064835 more ... Gtdc1 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO GTDC1 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Gtdc1 Mouse beta-lapachone decreases expression ISO GTDC1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of GTDC1 mRNA CTD PMID:38218311 Gtdc1 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of GTDC1 gene CTD PMID:33872906 Gtdc1 Mouse bisphenol A decreases expression ISO Gtdc1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of GTDC1 mRNA CTD PMID:25181051 Gtdc1 Mouse bisphenol A decreases methylation ISO GTDC1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of GTDC1 gene CTD PMID:31601247 Gtdc1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GTDC1 mRNA CTD PMID:33221593 Gtdc1 Mouse bisphenol A increases expression ISO Gtdc1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of GTDC1 mRNA CTD PMID:34947998 Gtdc1 Mouse bisphenol A increases methylation ISO Gtdc1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of GTDC1 gene CTD PMID:28505145 Gtdc1 Mouse butanal decreases expression ISO GTDC1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of GTDC1 mRNA CTD PMID:26079696 Gtdc1 Mouse CGP 52608 multiple interactions ISO GTDC1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GTDC1 gene] CTD PMID:28238834 Gtdc1 Mouse chlordecone multiple interactions EXP 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to GTDC1 gene] CTD PMID:31084621 Gtdc1 Mouse cisplatin decreases expression ISO GTDC1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of GTDC1 mRNA CTD PMID:27392435 Gtdc1 Mouse cisplatin multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of GTDC1 mRNA CTD PMID:27392435 Gtdc1 Mouse copper(II) sulfate decreases expression ISO GTDC1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GTDC1 mRNA CTD PMID:19549813 Gtdc1 Mouse Dibutyl phosphate affects expression ISO GTDC1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GTDC1 mRNA CTD PMID:37042841 Gtdc1 Mouse diethylstilbestrol increases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Diethylstilbestrol results in increased expression of GTDC1 mRNA CTD PMID:21658437 Gtdc1 Mouse dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of GTDC1 mRNA CTD PMID:22629407 Gtdc1 Mouse dioxygen multiple interactions EXP 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of GTDC1 mRNA] CTD PMID:22629407 Gtdc1 Mouse doxorubicin decreases expression ISO GTDC1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GTDC1 mRNA CTD PMID:29803840 Gtdc1 Mouse endosulfan decreases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of GTDC1 mRNA CTD PMID:29391264 Gtdc1 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of GTDC1 mRNA CTD PMID:30319688 Gtdc1 Mouse ethyl methanesulfonate decreases expression ISO GTDC1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of GTDC1 mRNA CTD PMID:23649840 Gtdc1 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of GTDC1 mRNA CTD PMID:22206623 Gtdc1 Mouse furan increases methylation ISO Gtdc1 (Rattus norvegicus) 6480464 furan results in increased methylation of GTDC1 gene CTD PMID:22079235 Gtdc1 Mouse gentamycin increases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of GTDC1 mRNA CTD PMID:33387578 Gtdc1 Mouse indole-3-methanol multiple interactions ISO Gtdc1 (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of GTDC1 mRNA CTD PMID:22129741 Gtdc1 Mouse manganese atom multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GTDC1 mRNA CTD PMID:39836092 Gtdc1 Mouse manganese(0) multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GTDC1 mRNA CTD PMID:39836092 Gtdc1 Mouse manganese(II) chloride multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GTDC1 mRNA CTD PMID:39836092 Gtdc1 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of GTDC1 mRNA CTD PMID:34813904 Gtdc1 Mouse methimazole decreases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Methimazole results in decreased expression of GTDC1 mRNA CTD PMID:30047161 Gtdc1 Mouse methotrexate increases expression ISO GTDC1 (Homo sapiens) 6480464 Methotrexate results in increased expression of GTDC1 mRNA CTD PMID:24449571 Gtdc1 Mouse methyl methanesulfonate decreases expression ISO GTDC1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of GTDC1 mRNA CTD PMID:23649840 Gtdc1 Mouse mono(2-ethylhexyl) phthalate multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of GTDC1 gene CTD PMID:33872906 Gtdc1 Mouse N,N-diethyl-m-toluamide multiple interactions ISO Gtdc1 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of GTDC1 gene CTD PMID:33148267 Gtdc1 Mouse N-nitrosodiethylamine multiple interactions ISO Gtdc1 (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of GTDC1 mRNA CTD PMID:22129741 Gtdc1 Mouse O-methyleugenol decreases expression ISO GTDC1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of GTDC1 mRNA CTD PMID:32234424 Gtdc1 Mouse oxaliplatin multiple interactions ISO Gtdc1 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of GTDC1 mRNA CTD PMID:25729387 Gtdc1 Mouse perfluorononanoic acid increases expression ISO GTDC1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of GTDC1 mRNA CTD PMID:32588087 Gtdc1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GTDC1 mRNA CTD PMID:36331819 Gtdc1 Mouse permethrin multiple interactions ISO Gtdc1 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of GTDC1 gene CTD PMID:33148267 Gtdc1 Mouse sodium arsenite multiple interactions ISO GTDC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GTDC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GTDC1 mRNA CTD PMID:39836092 Gtdc1 Mouse sodium dichromate affects expression ISO Gtdc1 (Rattus norvegicus) 6480464 sodium bichromate affects the expression of GTDC1 mRNA CTD PMID:22110744 Gtdc1 Mouse Soman decreases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Soman results in decreased expression of GTDC1 mRNA CTD PMID:19281266 Gtdc1 Mouse sulfadimethoxine decreases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of GTDC1 mRNA CTD PMID:30047161 Gtdc1 Mouse sunitinib increases expression ISO GTDC1 (Homo sapiens) 6480464 Sunitinib results in increased expression of GTDC1 mRNA CTD PMID:31533062 Gtdc1 Mouse thioacetamide decreases expression ISO Gtdc1 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of GTDC1 mRNA CTD PMID:34492290 Gtdc1 Mouse topotecan multiple interactions ISO Gtdc1 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of GTDC1 mRNA CTD PMID:25729387 Gtdc1 Mouse trichloroethene increases methylation ISO Gtdc1 (Rattus norvegicus) 6480464 Trichloroethylene results in increased methylation of GTDC1 gene CTD PMID:27618143 Gtdc1 Mouse trichostatin A decreases expression ISO GTDC1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of GTDC1 mRNA CTD PMID:24935251 Gtdc1 Mouse triptonide affects expression EXP 6480464 triptonide affects the expression of GTDC1 mRNA CTD PMID:33045310 Gtdc1 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of GTDC1 mRNA CTD PMID:17292431 and PMID:17963808 Gtdc1 Mouse valproic acid decreases expression ISO GTDC1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GTDC1 mRNA CTD PMID:23179753 more ... Gtdc1 Mouse valproic acid affects expression ISO GTDC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GTDC1 mRNA CTD PMID:25979313 Gtdc1 Mouse vinclozolin increases expression ISO Gtdc1 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of GTDC1 mRNA CTD PMID:23034163
(-)-alpha-phellandrene (ISO) (1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-diaminotoluene (EXP) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (EXP) aflatoxin B1 (EXP,ISO) aflatoxin M1 (ISO) alpha-phellandrene (ISO) amitrole (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) CGP 52608 (ISO) chlordecone (EXP) cisplatin (ISO) copper(II) sulfate (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (ISO) dioxygen (EXP) doxorubicin (ISO) endosulfan (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) folic acid (EXP) furan (ISO) gentamycin (ISO) indole-3-methanol (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (EXP) methimazole (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (ISO) N-nitrosodiethylamine (ISO) O-methyleugenol (ISO) oxaliplatin (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP) permethrin (ISO) sodium arsenite (ISO) sodium dichromate (ISO) Soman (ISO) sulfadimethoxine (ISO) sunitinib (ISO) thioacetamide (ISO) topotecan (ISO) trichloroethene (ISO) trichostatin A (ISO) triptonide (EXP) valproic acid (EXP,ISO) vinclozolin (ISO)
Gtdc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 44,454,420 - 44,817,761 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 44,454,424 - 44,817,669 (-) Ensembl GRCm39 Ensembl GRCm38 2 44,564,412 - 44,927,717 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 44,564,412 - 44,927,657 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 44,419,942 - 44,717,142 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 44,386,431 - 44,683,631 (-) NCBI MGSCv36 mm8 Celera 2 46,279,991 - 46,577,581 (-) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 27.27 NCBI
GTDC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 143,938,068 - 144,333,069 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 143,938,068 - 144,332,568 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 144,695,635 - 145,090,636 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 144,420,051 - 144,768,530 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 144,537,314 - 144,923,761 NCBI Celera 2 138,416,309 - 138,773,953 (-) NCBI Celera Cytogenetic Map 2 q22.3 NCBI HuRef 2 136,694,427 - 137,081,275 (-) NCBI HuRef CHM1_1 2 144,708,568 - 145,095,377 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 144,386,085 - 144,781,108 (-) NCBI T2T-CHM13v2.0
Gtdc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 49,176,110 - 49,571,594 (-) NCBI GRCr8 mRatBN7.2 3 28,766,640 - 29,161,668 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 28,766,645 - 29,162,271 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 32,164,654 - 32,554,967 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 40,749,692 - 41,139,997 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 38,568,394 - 38,958,706 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 29,410,426 - 29,705,981 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 29,410,426 - 29,705,985 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 34,615,976 - 34,911,407 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 25,042,343 - 25,345,382 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 3 27,077,114 - 27,374,815 (-) NCBI Celera Cytogenetic Map 3 q12 NCBI
Gtdc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955440 10,334,533 - 10,613,876 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955440 10,334,584 - 10,702,436 (-) NCBI ChiLan1.0 ChiLan1.0
GTDC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 30,580,758 - 30,966,173 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 30,595,689 - 30,981,144 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 15,512,420 - 15,899,477 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 148,024,000 - 148,370,779 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 148,026,117 - 148,312,426 (-) Ensembl panpan1.1 panPan2
GTDC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 45,971,203 - 46,273,888 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 19 45,973,109 - 46,365,143 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 46,225,123 - 46,618,749 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 47,431,445 - 47,824,801 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 47,431,457 - 47,824,757 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 46,089,792 - 46,482,874 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 46,221,623 - 46,614,340 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 47,616,846 - 48,009,770 (-) NCBI UU_Cfam_GSD_1.0
Gtdc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 108,826,282 - 109,182,381 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 32,539,891 - 32,790,374 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 32,514,679 - 32,791,418 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GTDC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 7,757,935 - 8,051,594 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 7,685,969 - 8,162,784 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 8,377,968 - 8,636,346 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GTDC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 29,275,462 - 29,674,966 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 29,293,207 - 29,548,585 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 169,883,093 - 170,289,268 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gtdc1
.
Predicted Target Of
Count of predictions: 1962 Count of miRNA genes: 806 Interacting mature miRNAs: 1034 Transcripts: ENSMUST00000049051, ENSMUST00000100127, ENSMUST00000112810, ENSMUST00000129240, ENSMUST00000130991, ENSMUST00000133442, ENSMUST00000134813, ENSMUST00000143333, ENSMUST00000143766, ENSMUST00000146694, ENSMUST00000148279, ENSMUST00000148786, ENSMUST00000154744 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8552707 Cia23_m collagen induced arthritis QTL 23 (mouse) Not determined 2 12129537 66556453 Mouse 12904005 Cfq2_m conditioned fear QTL 2 (mouse) 2 27022642 56396228 Mouse 14746979 Manh51_m mandible shape 51 (mouse) 2 28961129 62961129 Mouse 39128209 Lwq14_m liver weight QTL 14 (mouse) 2 20897778 118894840 Mouse 1558738 W6q1_m weight 6 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 11038703 Ltpr1_m Leishmania tropica response 1 (mouse) 2 39971665 73971811 Mouse 1301402 Ap2q_m alcohol preference 2 QTL (mouse) Not determined 2 43520612 77520756 Mouse 4142133 Pbwg1.6_m postnatal body weight growth 1.6 (mouse) Not determined 35797324 69797406 Mouse 4141236 Hbnr5_m Heligmosomoides bakeri nematode resistance 5 (mouse) Not determined 31214567 105143570 Mouse 26884438 Sklq12_m skull length QTL 12, 16 week (mouse) 2 24590012 54890012 Mouse 12904008 Cfq6_m conditioned fear QTL 6 (mouse) 2 31203035 44508204 Mouse 1302174 Dssc2_m dextran sodium sulfate induced colitis QTL2 (mouse) Not determined 2 24224632 148700377 Mouse 4142130 Pgis2_m proteoglycan induced spondylitis 2 (mouse) Not determined 2 25308051 56971811 Mouse 1559001 Eae33_m experimental allergic encephalomyelitis susceptibility 33 (mouse) Not determined 2 35991679 71609412 Mouse 4142447 Pbwg1.7_m postnatal body weight growth 1.7 (mouse) Not determined 35797324 69797406 Mouse 1301376 Etohc1_m ethanol consumption 1 (mouse) Not determined 2 21129725 55129871 Mouse 1558915 W3q1_m weight 3 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 14746997 Mancz2_m mandible centroid size 2 (mouse) 2 28961129 62961129 Mouse 12792980 Fbmd1_m femoral bone mineral density 1, females only (mouse) 2 25034492 45034492 Mouse 1301769 Orgwq2_m organ weight QTL 2 (mouse) Not determined 2 3887126 93421651 Mouse 1301641 Sbmd2_m spinal bone mineral density 2 (mouse) Not determined 2 14214567 48214713 Mouse 1357454 Kidq1_m kidney weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 10449151 Hdl8_m high density lipoprotein (HDL) level 8 (mouse) 2 38129725 67072607 Mouse 1558966 W10q9_m weight 10 weeks QTL 9 (mouse) Not determined 2 20897778 118894840 Mouse 4141854 T2dm2sa_m type 2 diabetes mellitus 2 in SMXA RI mice (mouse) Not determined 2 29307947 148374934 Mouse 10449150 Pvldlc1_m plasma VLDL-cholesterol 1 (mouse) 2 38129725 67072607 Mouse 13463470 Tubisq1_m tubulointerstitial injury severity, QTL 1 (mouse) 2 23689145 57689269 Mouse 1558899 Egq1_m early growth QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357681 Hrtq1_m heart weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 10449145 Lanq1_m lanosterol level QTL 1 (mouse) 2 38129725 67072607 Mouse 1301109 Dntcs2_m dental caries susceptibility 2 (mouse) Not determined 2 40885493 114910165 Mouse 1300788 Cia2_m collagen induced arthritis QTL 2 (mouse) Not determined 2 43520612 77520756 Mouse 1357436 Splq1_m spleen weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 10755532 Lymph5_m lymphocyte differential 5 (mouse) 2 44199017 78199017 Mouse 1300671 Cia4_m collagen induced arthritis QTL 4 (mouse) Not determined 2 43520612 77520756 Mouse 1357881 Estoq1_m embryo survival total QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 13464253 Ifvrq1_m influenza virus resistance QTL 1 (mouse) 2 33034492 52034492 Mouse 1301411 Pitm1_m prion incubation time 1 (mouse) Not determined 2 43520612 77520756 Mouse 1300577 Capsq1_m capsaicin sensitivity related QTL 1 (mouse) Not determined 2 27602060 84013384 Mouse 4141069 Pbwg1.5_m postnatal body weight growth 1.5 (mouse) Not determined 43520612 77520756 Mouse 4141708 Pbwg1.2_m postnatal body weight growth 1.2 (mouse) Not determined 21129725 55129871 Mouse 1301480 Pbwg1_m postnatal body weight growth 1 (mouse) Not determined 2 41820719 75820843 Mouse 4141186 Pbwg1.8_m postnatal body weight growth 1.8 (mouse) Not determined 35797324 69797406 Mouse
D10Mit157.2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 D1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 18 E2 UniSTS Cytogenetic Map 4 C3 UniSTS Cytogenetic Map 7 B2 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 14 E2.2 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 6 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 17 A1 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 8 C1 UniSTS Cytogenetic Map 18 A2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 E2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 14 C2 UniSTS Cytogenetic Map 6 A1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 13 D2.1 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 17 E3 UniSTS Cytogenetic Map 11 B3 UniSTS Cytogenetic Map 1 H4 UniSTS Cytogenetic Map 6 A3 UniSTS Cytogenetic Map 5 E4-E5 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 13 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 14 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map X D UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 1 H2.3 UniSTS Cytogenetic Map 7 A2 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 15 D2 UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 16 B2 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 1 C4 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 F3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 9 A4 UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 1 A5 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 6 G1 UniSTS Cytogenetic Map X A2 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 9 B UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 10 A4 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 18 A1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 1 C2 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 1 B UniSTS Cytogenetic Map 17 A3.1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 15 A2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map 4 A3 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 8 A1 UniSTS Cytogenetic Map 8 A1.1 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 10 B1 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 10 A1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 4 A1 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 17 C UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 5 E3 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 14 C1 UniSTS Cytogenetic Map 14 E5 UniSTS Cytogenetic Map 10 C UniSTS Cytogenetic Map 18 B2 UniSTS Cytogenetic Map 2 F1 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 17 A2 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 B2 UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 13 C3 UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 13 C1 UniSTS Cytogenetic Map 9 E3.1 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X E3 UniSTS Cytogenetic Map 4 C4 UniSTS Cytogenetic Map 3 E3 UniSTS Cytogenetic Map 11 A4 UniSTS Cytogenetic Map 4 C5 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 7 E1 UniSTS Cytogenetic Map 5 D-E1 UniSTS Cytogenetic Map 5 B3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 5 A2 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 17 E4 UniSTS Cytogenetic Map 1 G2 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 4 D2.1 UniSTS Cytogenetic Map 4 A5 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 1 E3-E4 UniSTS Cytogenetic Map 9 F1-F3 UniSTS Cytogenetic Map 1 C1.1 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 12 A2 UniSTS Cytogenetic Map 17 A3-B UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 14 A3 UniSTS Cytogenetic Map 5 G1.1 UniSTS Cytogenetic Map X F2-F4 UniSTS Cytogenetic Map 7 D2 UniSTS Cytogenetic Map 2 F3 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 9 F1-F2 UniSTS Cytogenetic Map 13 A3.2 UniSTS Cytogenetic Map 10 A2 UniSTS Cytogenetic Map 1 C1 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 12 D3 UniSTS Cytogenetic Map 1 A3-A5 UniSTS Cytogenetic Map 2 A2 UniSTS Cytogenetic Map 3 A1 UniSTS Cytogenetic Map X A3.3 UniSTS Cytogenetic Map 16 A-B1 UniSTS Cytogenetic Map 1 D2.3 UniSTS Cytogenetic Map 6 B2.3 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map X A2-A3.1 UniSTS Cytogenetic Map 9 A5.3 UniSTS Cytogenetic Map 14 A2-B UniSTS Cytogenetic Map 8 E1-E2 UniSTS Cytogenetic Map 8 A3 UniSTS Cytogenetic Map 1 G3-H1 UniSTS Cytogenetic Map 8 B3-C1 UniSTS Cytogenetic Map 19 C1 UniSTS Cytogenetic Map 8 C5 UniSTS Cytogenetic Map 8 A4 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 14 E4 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map X F5 UniSTS cM Map 10 40.0 UniSTS Whitehead Genetic 10 33.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000049051 ⟹ ENSMUSP00000038119
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,454,427 - 44,646,449 (-) Ensembl GRCm38.p6 Ensembl 2 44,564,415 - 44,756,437 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000100127 ⟹ ENSMUSP00000097703
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,675,502 - 44,817,248 (-) Ensembl GRCm38.p6 Ensembl 2 44,785,490 - 44,927,236 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000112810 ⟹ ENSMUSP00000108429
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,454,424 - 44,751,634 (-) Ensembl GRCm38.p6 Ensembl 2 44,564,412 - 44,861,622 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000129240
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,523,141 - 44,817,276 (-) Ensembl GRCm38.p6 Ensembl 2 44,633,129 - 44,927,264 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000130991 ⟹ ENSMUSP00000116839
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,465,490 - 44,817,173 (-) Ensembl GRCm38.p6 Ensembl 2 44,575,478 - 44,927,161 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000133442
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,681,205 - 44,817,161 (-) Ensembl GRCm38.p6 Ensembl 2 44,791,193 - 44,927,149 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000134813
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,455,145 - 44,461,359 (-) Ensembl GRCm38.p6 Ensembl 2 44,565,133 - 44,571,347 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000143333
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,460,382 - 44,461,726 (-) Ensembl GRCm38.p6 Ensembl 2 44,570,370 - 44,571,714 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000143766
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,678,740 - 44,817,246 (-) Ensembl GRCm38.p6 Ensembl 2 44,788,728 - 44,927,234 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000146694 ⟹ ENSMUSP00000119639
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,481,922 - 44,752,287 (-) Ensembl GRCm38.p6 Ensembl 2 44,591,910 - 44,862,275 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000148279 ⟹ ENSMUSP00000120593
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,525,276 - 44,817,669 (-) Ensembl GRCm38.p6 Ensembl 2 44,635,264 - 44,927,657 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000148786
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,641,907 - 44,715,415 (-) Ensembl GRCm38.p6 Ensembl 2 44,751,895 - 44,825,403 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000154744 ⟹ ENSMUSP00000119239
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 44,646,280 - 44,752,287 (-) Ensembl GRCm38.p6 Ensembl 2 44,756,268 - 44,862,275 (-) Ensembl
RefSeq Acc Id:
NM_001362986 ⟹ NP_001349915
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,454,424 - 44,817,729 (-) NCBI GRCm38 2 44,564,412 - 44,927,717 (-) NCBI
Sequence:
GCAGGAGGGTGTGCACTCGCCTTGCGGGGTCCCCGAGGCTTAGGCGCGCCCGGAAGGACAGGGAAGGGGACTACAGGTGCCGGCTAGCCACCTGCCTGAGAACGTGCGAGCCGGTACAAGATTGGATA
hide sequence
RefSeq Acc Id:
NM_001362987 ⟹ NP_001349916
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,454,424 - 44,817,248 (-) NCBI GRCm38 2 44,564,412 - 44,927,236 (-) NCBI
Sequence:
GGAGGGGCTCGGCGTCAGCGCGTCGCCAGCTGGGCTGTCGGTGGCCTGGAGGGAGCCGTGGAGGAGGAGGAGGAGAGGAGGAGGAGGAGGAGGAGGTACAAGATTGGATATCAGTTCATCTGGATCAG
hide sequence
RefSeq Acc Id:
NM_172662 ⟹ NP_766250
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,454,424 - 44,751,634 (-) NCBI GRCm38 2 44,564,412 - 44,861,622 (-) NCBI MGSCv37 2 44,419,942 - 44,717,142 (-) RGD Celera 2 46,279,981 - 46,577,581 (-) NCBI cM Map 2 ENTREZGENE
Sequence:
AAGACAGCAGGCTGAGCAAGCCAGGGGAAGCAAGCCAGTAAAGAACATCCCTCCATGGCCTCTGCATCAGCTCCTGCTTCCTGACCTGCTTGAGTTCCAGTCCTGACTTCCTTGGTGATGAACAGCAA
hide sequence
RefSeq Acc Id:
NR_156429
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,677,124 - 44,817,248 (-) NCBI GRCm38 2 44,787,112 - 44,927,236 (-) NCBI
Sequence:
GGAGGGGCTCGGCGTCAGCGCGTCGCCAGCTGGGCTGTCGGTGGCCTGGAGGGAGCCGTGGAGG
hide sequence
RefSeq Acc Id:
NR_156430
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,675,502 - 44,817,248 (-) NCBI GRCm38 2 44,785,490 - 44,927,236 (-) NCBI
Sequence:
GGAGGGGCTCGGCGTCAGCGCGTCGCCAGCTGGGCTGTCGGTGGCCTGGAGGGAGCCGTGGAGGAGGAGGAGGAGAGGAGGAGGAGGAGGAGGAGGTACAAGATTGGATATCAGTTCATCTGGATCAG
hide sequence
RefSeq Acc Id:
XM_011239091 ⟹ XP_011237393
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,454,420 - 44,810,762 (-) NCBI GRCm38 2 44,564,412 - 44,920,803 (-) NCBI
Sequence:
CTTCTTCTTTAAATGTAAACAGTTCACACTGATGTGCCCTAGCATTGCGTAAGTCAGTGGACTTTGCTCTCTGACATTGCCTTTAGATGATCTCCTTTACTTGAAGCATGTGAGAACATACCTATTAT
hide sequence
RefSeq Acc Id:
XM_030250118 ⟹ XP_030105978
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,477,096 - 44,817,296 (-) NCBI GRCm38 2 44,587,084 - 44,927,299 (-) NCBI
Sequence:
GCGGCAGCCGCAGCGGGGAGGGGCTGCGGCCTCGGTGGCGGCCGCGGGGGAGGGGCTCGGCGTCAGCGCGTCGCCAGCTGGGCTGTCGGTGGCCTGGAGGGAGCCGTGGAGGAGGAGGAGGAGAGGAG
hide sequence
RefSeq Acc Id:
XR_003952196
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,454,420 - 44,817,296 (-) NCBI GRCm38 2 44,564,412 - 44,927,299 (-) NCBI
Sequence:
GCGGCAGCCGCAGCGGGGAGGGGCTGCGGCCTCGGTGGCGGCCGCGGGGGAGGGGCTCGGCGTC
hide sequence
RefSeq Acc Id:
XR_003952199
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 44,454,420 - 44,817,761 (-) NCBI GRCm38 2 44,564,412 - 44,927,674 (-) NCBI
Sequence:
GGGGGGAAAGCGGGGCGTGCTGACCAATACCTGCAGGAGGGTGTGCACTCGCCTTGCGGGGTCCCCGAGGCTTAGGCGCGCCCGGAAGGACAGGGAAGGGGACTACAGGTGCCGGCTAGCCACCTGCC
hide sequence
RefSeq Acc Id:
NP_766250 ⟸ NM_172662
- UniProtKB:
Q80US3 (UniProtKB/Swiss-Prot), Q3TQ41 (UniProtKB/Swiss-Prot), A2AVU2 (UniProtKB/Swiss-Prot), A2AQS2 (UniProtKB/Swiss-Prot), A2AQR9 (UniProtKB/Swiss-Prot), Q8C1B8 (UniProtKB/Swiss-Prot), Q8BW56 (UniProtKB/Swiss-Prot), G8JL42 (UniProtKB/TrEMBL)
- Sequence:
MSIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSSEHYRTLFASSVLNLTELAALRPDLGKLKKILYFHENQLVYPVKKYQERDFQYGYNQILSCLVADVVVFNSSF
hide sequence
RefSeq Acc Id:
XP_011237393 ⟸ XM_011239091
- Peptide Label:
isoform X1
- UniProtKB:
Q80US3 (UniProtKB/Swiss-Prot), Q3TQ41 (UniProtKB/Swiss-Prot), A2AVU2 (UniProtKB/Swiss-Prot), A2AQS2 (UniProtKB/Swiss-Prot), A2AQR9 (UniProtKB/Swiss-Prot), Q8C1B8 (UniProtKB/Swiss-Prot), Q8BW56 (UniProtKB/Swiss-Prot), G8JL42 (UniProtKB/TrEMBL)
- Sequence:
MSIVIIEAFYGGSHRQLVELLREELDDCVLYTLPAKKWHWRARTAALYFSQNIPSSEHYRTLFA
hide sequence
RefSeq Acc Id:
NP_001349915 ⟸ NM_001362986
- UniProtKB:
Q8BW56 (UniProtKB/Swiss-Prot), Q80US3 (UniProtKB/Swiss-Prot), Q3TQ41 (UniProtKB/Swiss-Prot), A2AVU2 (UniProtKB/Swiss-Prot), A2AQS2 (UniProtKB/Swiss-Prot), A2AQR9 (UniProtKB/Swiss-Prot), Q8C1B8 (UniProtKB/Swiss-Prot), G8JL42 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001349916 ⟸ NM_001362987
- UniProtKB:
Q8BW56 (UniProtKB/Swiss-Prot), Q80US3 (UniProtKB/Swiss-Prot), Q3TQ41 (UniProtKB/Swiss-Prot), A2AVU2 (UniProtKB/Swiss-Prot), A2AQS2 (UniProtKB/Swiss-Prot), A2AQR9 (UniProtKB/Swiss-Prot), Q8C1B8 (UniProtKB/Swiss-Prot), G8JL42 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030105978 ⟸ XM_030250118
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSMUSP00000116839 ⟸ ENSMUST00000130991
Ensembl Acc Id:
ENSMUSP00000038119 ⟸ ENSMUST00000049051
Ensembl Acc Id:
ENSMUSP00000119639 ⟸ ENSMUST00000146694
Ensembl Acc Id:
ENSMUSP00000108429 ⟸ ENSMUST00000112810
Ensembl Acc Id:
ENSMUSP00000119239 ⟸ ENSMUST00000154744
Ensembl Acc Id:
ENSMUSP00000120593 ⟸ ENSMUST00000148279
Ensembl Acc Id:
ENSMUSP00000097703 ⟸ ENSMUST00000100127
RGD ID: 6877244 Promoter ID: EPDNEW_M2073 Type: multiple initiation site Name: Gtdc1_2 Description: Mus musculus glycosyltransferase-like domain containing 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M2074 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 44,856,899 - 44,856,959 EPDNEW
RGD ID: 6877246 Promoter ID: EPDNEW_M2074 Type: multiple initiation site Name: Gtdc1_1 Description: Mus musculus glycosyltransferase-like domain containing 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M2073 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 44,927,223 - 44,927,283 EPDNEW
