Advanced Search (OLGA)

Gene: Crnn (cornulin) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Crnn

Name:

cornulin

RGD ID:

1619680

MGI Page

MGI

Description:

Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Predicted to be involved in several processes, including positive regulation of NF-kappaB transcription factor activity; positive regulation of cell cycle G1/S phase transition; and positive regulation of keratinocyte proliferation. Predicted to be located in cytoplasm and membrane. Is expressed in epidermis; esophagus epithelium; and nail. Orthologous to human CRNN (cornulin).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Gm1015

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CRNN (cornulin)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Rattus norvegicus (Norway rat):	Crnn (cornulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Crnn (cornulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CRNN (cornulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CRNN (cornulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Crnn (cornulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CRNN (cornulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CRNN (cornulin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	S100P (S100 calcium binding protein P)	HGNC	Treefam
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Crnn (cornulin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CRNN (cornulin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	93,052,096 - 93,057,125 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	93,052,094 - 93,057,126 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	93,144,789 - 93,149,818 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	93,144,787 - 93,149,819 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	92,948,709 - 92,953,393 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	93,230,190 - 93,234,874 (+)	NCBI		MGSCv36	mm8
MGSCv36	3	93,859,775 - 93,864,459 (+)	NCBI		MGSCv36	mm8
Celera	3	93,928,821 - 93,933,495 (-)	NCBI		Celera
Cytogenetic Map	3	F2.1	NCBI
cM Map	3	40.14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Crnn	Mouse	gastrointestinal stromal tumor		ISO	CRNN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Crnn	Mouse	immunodeficiency 42		ISO	CRNN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive mendelian susceptibility to mycobacterial diseases due to complete RORgamma receptor deficiency	ClinVar	PMID:28492532
Crnn	Mouse	MHC class II deficiency		ISO	CRNN (Homo sapiens)	8554872	ClinVar Annotator: match by term: MHC class II deficiency	ClinVar	PMID:28492532
Crnn	Mouse	parathyroid carcinoma		ISO	CRNN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Crnn	Mouse	severe congenital neutropenia 3		ISO	CRNN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Kostmann syndrome	ClinVar	PMID:28492532
Crnn	Mouse	severe congenital neutropenia 5		ISO	CRNN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital neutropenia-myelofibrosis-nephromegaly syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Crnn	Mouse	all-trans-retinoic acid	increases expression	ISO	CRNN (Homo sapiens)	6480464	Tretinoin results in increased expression of CRNN mRNA	CTD	PMID:25240866
Crnn	Mouse	alpha-Zearalanol	multiple interactions	ISO	Crnn (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CRNN mRNA	CTD	PMID:35163327
Crnn	Mouse	alpha-Zearalanol	decreases expression	ISO	Crnn (Rattus norvegicus)	6480464	Zeranol results in decreased expression of CRNN mRNA	CTD	PMID:35163327
Crnn	Mouse	arsane	multiple interactions	ISO	CRNN (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CRNN mRNA	CTD	PMID:32525701
Crnn	Mouse	arsenic atom	multiple interactions	ISO	CRNN (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CRNN mRNA	CTD	PMID:32525701
Crnn	Mouse	benzo[a]pyrene	increases methylation	ISO	CRNN (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of CRNN 5' UTR	CTD	PMID:27901495
Crnn	Mouse	bisphenol A	decreases expression	ISO	Crnn (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of CRNN mRNA	CTD	PMID:25181051
Crnn	Mouse	bisphenol A	multiple interactions	ISO	CRNN (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of CRNN gene	CTD	PMID:31601247
Crnn	Mouse	CGP 52608	multiple interactions	ISO	CRNN (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to CRNN gene]	CTD	PMID:28238834
Crnn	Mouse	crocidolite asbestos	increases expression	ISO	CRNN (Homo sapiens)	6480464	Asbestos and Crocidolite results in increased expression of CRNN mRNA	CTD	PMID:25351596
Crnn	Mouse	fulvestrant	multiple interactions	ISO	CRNN (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in increased methylation of CRNN gene	CTD	PMID:31601247
Crnn	Mouse	methotrexate	increases expression	ISO	CRNN (Homo sapiens)	6480464	Methotrexate results in increased expression of CRNN mRNA	CTD	PMID:24449571
Crnn	Mouse	paracetamol	decreases expression	ISO	CRNN (Homo sapiens)	6480464	Acetaminophen results in decreased expression of CRNN mRNA	CTD	PMID:22230336
Crnn	Mouse	perfluorooctanoic acid	multiple interactions	ISO	Crnn (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CRNN mRNA	CTD	PMID:35163327
Crnn	Mouse	resveratrol	multiple interactions	ISO	CRNN (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of CRNN mRNA	CTD	PMID:23557933
Crnn	Mouse	sodium arsenate	multiple interactions	ISO	CRNN (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CRNN mRNA	CTD	PMID:32525701
Crnn	Mouse	sodium arsenite	affects expression	ISO	CRNN (Homo sapiens)	6480464	sodium arsenite affects the expression of CRNN mRNA	CTD	PMID:34032870
Crnn	Mouse	sodium dodecyl sulfate	increases expression	ISO	CRNN (Homo sapiens)	6480464	Sodium Dodecyl Sulfate results in increased expression of CRNN mRNA	CTD	PMID:25240866
Crnn	Mouse	sodium fluoride	increases expression	ISO	Crnn (Rattus norvegicus)	6480464	Sodium Fluoride results in increased expression of CRNN mRNA	CTD	PMID:27257137
Crnn	Mouse	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of CRNN mRNA	CTD	PMID:35295148
Crnn	Mouse	valproic acid	decreases methylation	ISO	CRNN (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of CRNN gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Crnn	Mouse	cell-cell adhesion	involved_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119
Crnn	Mouse	cellular response to cytokine stimulus	involved_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119
Crnn	Mouse	positive regulation of cell cycle G1/S phase transition	involved_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119
Crnn	Mouse	positive regulation of keratinocyte proliferation	involved_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119
Crnn	Mouse	positive regulation of NF-kappaB transcription factor activity	involved_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119
Crnn	Mouse	regulation of gene expression	involved_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119
Crnn	Mouse	regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	IBA	PANTHER:PTN004281055 and UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000033
Crnn	Mouse	regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	involved_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119
Crnn	Mouse	response to heat	involved_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Crnn	Mouse	cytoplasm	located_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119
Crnn	Mouse	membrane	located_in	ISO	UniProtKB:Q9UBG3	2290270		GO_Central	GO_REF:0000119

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Crnn	Mouse	calcium ion binding	enables	IBA	PANTHER:PTN007521306 more ...	2290270		GO_Central	GO_REF:0000033
Crnn	Mouse	calcium-dependent protein binding	enables	IBA	PANTHER:PTN007521306 more ...	2290270		GO_Central	GO_REF:0000033
Crnn	Mouse	protein binding	enables	ISO	UniProtKB:P61968	9068941	PMID:32296183	IntAct	PMID:32296183

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:15854041	PMID:16602821	PMID:21873635	PMID:24780931	PMID:26371508

Crnn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	93,052,096 - 93,057,125 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	93,052,094 - 93,057,126 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	93,144,789 - 93,149,818 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	93,144,787 - 93,149,819 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	92,948,709 - 92,953,393 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	93,230,190 - 93,234,874 (+)	NCBI		MGSCv36	mm8
MGSCv36	3	93,859,775 - 93,864,459 (+)	NCBI		MGSCv36	mm8
Celera	3	93,928,821 - 93,933,495 (-)	NCBI		Celera
Cytogenetic Map	3	F2.1	NCBI
cM Map	3	40.14	NCBI

CRNN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	152,409,243 - 152,414,263 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	152,409,243 - 152,414,263 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	152,381,719 - 152,386,739 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	150,648,343 - 150,653,352 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	149,194,791 - 149,199,801	NCBI
Celera	1	125,492,515 - 125,497,547 (-)	NCBI		Celera
Cytogenetic Map	1	q21.3	NCBI
HuRef	1	123,755,264 - 123,760,295 (-)	NCBI		HuRef
CHM1_1	1	153,777,068 - 153,782,100 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	151,545,792 - 151,550,812 (-)	NCBI		T2T-CHM13v2.0

Crnn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	181,427,384 - 181,432,142 (+)	NCBI		GRCr8
mRatBN7.2	2	178,733,329 - 178,736,404 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	178,731,796 - 178,736,216 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	2	193,427,097 - 193,432,070 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	193,429,176 - 193,431,487 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	211,438,738 - 211,441,049 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	186,149,368 - 186,151,679 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	186,099,473 - 186,101,785 (+)	NCBI
Celera	2	171,521,128 - 171,526,101 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

Crnn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955589	47,531 - 77,458 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955589	47,743 - 75,383 (+)	NCBI	ChiLan1.0	ChiLan1.0

CRNN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	97,437,247 - 97,443,129 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	97,188,342 - 97,194,222 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	127,743,094 - 127,748,737 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	131,377,596 - 131,382,626 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

CRNN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	61,380,706 - 61,386,294 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	61,380,706 - 61,386,504 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	60,840,017 - 60,845,597 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	62,407,268 - 62,412,848 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	62,407,260 - 62,412,765 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	61,233,298 - 61,238,877 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	61,327,675 - 61,331,601 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	62,054,619 - 62,060,199 (-)	NCBI		UU_Cfam_GSD_1.0

Crnn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	23,484,401 - 23,487,188 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936580	2,513,644 - 2,517,221 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CRNN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	96,933,287 - 96,939,662 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	96,933,221 - 96,938,980 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	105,929,623 - 105,935,333 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CRNN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	11,280,298 - 11,285,906 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	10,772,390 - 10,775,555 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Crnn
240 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	94
Count of miRNA genes:	92
Interacting mature miRNAs:	94
Transcripts:	ENSMUST00000107300
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4142399	Aec1_m	autoimmune exocrinopathy 1 (mouse)			Not determined			7586174	102690034	Mouse
26884378	Skwq6_m	skull length QTL 6, 10 week (mouse)					3	51907421	102307316	Mouse
1301971	Cia5_m	collagen induced arthritis QTL 5 (mouse)			Not determined		3	66046658	100046795	Mouse
1301392	Eae3_m	susceptibility to experimental allergic encephalomyelitis 3 (mouse)			Not determined		3	79548730	113548837	Mouse
1301904	Iba2_m	induction of brown adipocytes 2 (mouse)			Not determined		3	82147043	116147184	Mouse
26884382	Bzwq1_m	bi-zygomatic width QTL 1, 5 week (mouse)					3	52207421	137205761	Mouse
11041900	Lmr11a_m	leishmaniasis resistance 11a (mouse)					3	83463991	117464137	Mouse
1301398	Rapop3_m	radiation-induced apoptosis 3 (mouse)			Not determined		3	90511217	100464137	Mouse
26884380	Skwq1_m	skull length QTL 1, 5 week (mouse)					3	43954435	101607316	Mouse
14746984	Manh54_m	mandible shape 54 (mouse)					3	85289152	119289152	Mouse
12738440	Twq3_m	testis weight QTL 3 (mouse)					3	87228015	121228015	Mouse
25314313	Syncl1_m	synaptonemal complex length 1 (mouse)					3	67907333	128393649	Mouse
1301272	Cfsw1_m	cystic fibrosis survival to weaning 1 (mouse)			Not determined		3	83882912	117883044	Mouse
1301791	Char4_m	P. chabaudi malaria resistance QTL 4 (mouse)			Not determined		3	69625509	100655290	Mouse
11049572	Lmr11c_m	leishmaniasis resistance 11c (mouse)					3	72139967	106140094	Mouse
26884436	Zlq3_m	zygomatic length QTL 3, 10 week (mouse)					3	3265060	142405761	Mouse
26884427	Cvht4_m	cranial vault height 4, 10 week (mouse)					3	16054164	109707316	Mouse
4141294	Bmd24_m	bone mineral density 24 (mouse)			Not determined		3	61740061	95740241	Mouse
10766455	Sle22_m	systematic lupus erythematosus susceptibility 22 (mouse)					3	90376936	124377072	Mouse
14747001	Mancz4_m	mandible centroid size 4 (mouse)					3	90378017	124378017	Mouse
1301705	Sles3_m	systemic lupus erythmatosus suppressor 3 (mouse)			Not determined		3	37174862	143353183	Mouse
13207570	Tcq12_m	total cholesterol QTL 12 (mouse)					3	16504164	130163649	Mouse
1357583	Sle18_m	systematic lupus erythematosus susceptibility 18 (mouse)			Not determined		3	87208904	125316236	Mouse
26884422	Cvht7_m	cranial vault height 7, 16 week (mouse)					3	28954149	118893649	Mouse
4142178	Ctrq2_m	C. trachomatis resistance QTL 2 (mouse)			Not determined		3	89139967	137453008	Mouse
1300595	Tmevd2_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 2 (mouse)			Not determined		3	75463302	109463549	Mouse
11251721	Ewc3_m	ethanol withdrawal and consumption 3 (mouse)					3	69568554	103568554	Mouse
1300982	Lmr11_m	leishmaniasis resistance 11 (mouse)			Not determined		3	72139967	106140094	Mouse
1301947	Pcfm3_m	periosteal circumference and femur length 3 (mouse)			Not determined		3	81084652	115084797	Mouse
4142099	Cq3_m	cholesterol QTL 3 (mouse)			Not determined		3	84888918	118889067	Mouse
11039512	Ltpr3b_m	Leishmania tropica response 3b (mouse)					3	83463991	117464137	Mouse
1301349	Pgia26_m	proteoglycan induced arthritis 26 (mouse)			Not determined		3	92251533	126251650	Mouse
11039519	Ltpr3_m	Leishmania tropica response 3 (mouse)					3	56704102	100464137	Mouse
1302052	Etohcta4_m	ethanol conditioned taste aversion 4 (mouse)			Not determined		3	91000105	125008748	Mouse
1302056	Orgwq4_m	organ weight QTL 4 (mouse)			Not determined		3	30067588	147304689	Mouse
11039507	Ltpr3g_m	Leishmania tropica response 3g (mouse)					3	83463991	117464137	Mouse
11039508	Ltpr3f_m	Leishmania tropica response 3f (mouse)					3	83463991	117464137	Mouse
1301422	Sle11_m	systematic lupus erythematosus susceptibility 11 (mouse)			Not determined		3	70208904	104209042	Mouse
11039509	Ltpr3e_m	Leishmania tropica response 3e (mouse)					3	83463991	117464137	Mouse
11039510	Ltpr3d_m	Leishmania tropica response 3d (mouse)					3	83463991	117464137	Mouse
13208566	Bmiq5_m	body mass index QTL 5 (mouse)					3	40954435	115793649	Mouse
11039511	Ltpr3c_m	Leishmania tropica response 3c (mouse)					3	83463991	117464137	Mouse

D3Umi1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	93,148,199 - 93,148,605	UniSTS	GRCm38
MGSCv37	3	92,952,121 - 92,952,527	UniSTS	GRCm37
Celera	3	93,929,687 - 93,930,093	UniSTS
Cytogenetic Map	3	F2.1	UniSTS
cM Map	3		UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001081200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000107300 ⟹ ENSMUSP00000102921

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	93,052,094 - 93,056,778 (+)	Ensembl
GRCm38.p6 Ensembl	3	93,144,787 - 93,149,471 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000192372 ⟹ ENSMUSP00000141904

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	93,055,517 - 93,057,125 (+)	Ensembl
GRCm38.p6 Ensembl	3	93,148,210 - 93,149,818 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000195515 ⟹ ENSMUSP00000141980

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	93,052,096 - 93,057,126 (+)	Ensembl
GRCm38.p6 Ensembl	3	93,144,789 - 93,149,819 (+)	Ensembl

RefSeq Acc Id:

NM_001081200 ⟹ NP_001074669

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	3	93,052,096 - 93,057,125 (+)	NCBI
GRCm38	3	93,144,789 - 93,149,818 (+)	NCBI
MGSCv37	3	92,948,709 - 92,953,393 (+)	RGD
Celera	3	93,928,821 - 93,933,495 (-)	RGD
cM Map	3		ENTREZGENE

Sequence:

show sequence

ACTCTACACACTGCTTAACAGAAACTTGTCCCATCCTGCCTGAGCATTAGCATAGCTTCAAAGATGCCTCAGTTGCTGCAAAACATCCACGGGATCATCGAAGCCTTCGGGTGCTATGCCAGGTCAGA
GGGTGGCTGCAAAGTACTCACGAGGCAGGAGTTGAAGAGGCTCCTGGAACATGAGTTTGCTGACGTCATAGTGAAGCCCCATGATCCTGCAACTGTGGATGAAGTCCTGCGCCTGTTGGATGAAGATA
ACACAGGGACTGTAGAGTTCAAGGAATTCCTAGTCTTGGTGTTTAAAGTTGCACGGGCTTGCTTTAAGACACTGAATGAGAGTCCTAAGGGTGCTTGCATATCTGACAAGTCTGAAGGCTGCTATTCT
GGATCTTCAAAAGAGCTGGAGCAAAGACAGAGAGGTGGTGCTGAAGTGGCAAAAGACGGAGCAGCACAGCACTGTGAAGACAGCAGCTGTGGACAGAGAGATCAGGCTTCTAGAGGACAGGACAGGGT
TGGGACACATACCCAGAATCAGGACAGCTACCCTACACAGGTCAGCAGTCATGACAGGCAGACTGAGTCTCAGACACAGGAAATGATAAGCCAACAAACACAAGTGACAGGACAGGTGGAGCAGACCC
CAAGAACAGAAGACAAGAGTTGGACCAGACAGAAGAGGTCAGAGAGGCAACCACAGAGTAGCCAACAGACAGATGAGATCACAACTGGATCTACAGCTCAGACCCAAGCAGGTAACTTCTACACACAG
GGGTCTACCTGTGACTATAACAGAGGAACTAACAGCCATCACCAAGACAGAAGCCATGCAGACAGAGCTTCTACACAACACTACCAGACACAGGCAGGGTCTCATACTCAGATACACACACAGATGGT
AGAACAGGCCTGGGGGCAGCAAACAGGAAGTGATAGCATCCAGACACAGGGGTCTATCTATGACCAGAGCACTGAGACTGTGATTCATGGCCAAGACAGGAACCAGGCAAGCCAGAGTGTTAAAGAAC
ACCACCAGGCACAGGGAGAGTCATATATTCAGACACATACTCAGACAATGGAACAAGGCAGGAGCCAGCAGGCAGAAAATAGTAGCACCCAGACTCATGGGTCCATGTATGGCCAAAACAGAGAGACT
GAGATCCATGGGCTAGAAAGCAGTCAGGCAGAACAGGTGGGGACAAGACACTACCAGACACAGGCAGGATCATATACCCAGACTTTGGAACATGATGGGAGCCAGTCTGCACATAAATTTGTGGCTCA
AGAAAAGGAACGTACACAGACAAAGCCATGCATGGGGCAAAGCTGGACACCAGTAAGCAACTATGAGACAGAAGAGTCAGTGATAGGAGGACAGGTCCAGACTGAGACAGACACTATTATAGAGAATC
ACCCAAGCCCGACAGCCAGGCAGGTAGAGAGAGTACCCACAGTGGTTAGAGAGGAGTGGGTCAATGACCACACAAGGGAAATAGTAATCCGAAGCCAGGATCCAGGTAGCCTGCACTCTGGTACTCCT
TCAGCTCAGGGCCAGGATATACCACAGATGGAGAAGAAAGGAATCACAGCCAAGGGACTATATACCTACTTGAAGACAGAGCAGCCATGACTTTTCCCGATTCCAGCTGGAGTGAGGTTGGCCTGCCC
TGCCCTGCCCTGCCCTGCCCTGCCCTGCCCTGCCCTGCCCTGCCCTGCCATGGTACTTCACCAGACAGCCATGATTCTTCTTGTTTGGTTCTTTTACAGTGATCATCTCTACAAGGTGATTTCTTGTC
AAAACTCACCTCTCTTACCTGCTGCTCTCAGAAACTCACCTCTCTTACCTGATATTCTCAGAAACAGGAAGATGTGGAGGAGGTCATCTCATTGCACTGAATTCCCCCCAATTTTCAGGGGGTTTCAA
AGCTGTTTTATCTCTGGTATCTGTCCATTGCATCAATAAAGGCTTAGAAGCTG

hide sequence


Protein RefSeqs	NP_001074669	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000102921
	ENSMUSP00000102921.2
	ENSMUSP00000141904.2
	ENSMUSP00000141980.2

RefSeq Acc Id:

NP_001074669 ⟸ NM_001081200

- UniProtKB:

D3YUU6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPQLLQNIHGIIEAFGCYARSEGGCKVLTRQELKRLLEHEFADVIVKPHDPATVDEVLRLLDEDNTGTVEFKEFLVLVFKVARACFKTLNESPKGACISDKSEGCYSGSSKELEQRQRGGAEVAKDGA
AQHCEDSSCGQRDQASRGQDRVGTHTQNQDSYPTQVSSHDRQTESQTQEMISQQTQVTGQVEQTPRTEDKSWTRQKRSERQPQSSQQTDEITTGSTAQTQAGNFYTQGSTCDYNRGTNSHHQDRSHAD
RASTQHYQTQAGSHTQIHTQMVEQAWGQQTGSDSIQTQGSIYDQSTETVIHGQDRNQASQSVKEHHQAQGESYIQTHTQTMEQGRSQQAENSSTQTHGSMYGQNRETEIHGLESSQAEQVGTRHYQTQ
AGSYTQTLEHDGSQSAHKFVAQEKERTQTKPCMGQSWTPVSNYETEESVIGGQVQTETDTIIENHPSPTARQVERVPTVVREEWVNDHTREIVIRSQDPGSLHSGTPSAQGQDIPQMEKKGITAKGLY
TYLKTEQP

hide sequence

Ensembl Acc Id:

ENSMUSP00000102921 ⟸ ENSMUST00000107300

Ensembl Acc Id:

ENSMUSP00000141904 ⟸ ENSMUST00000192372

Ensembl Acc Id:

ENSMUSP00000141980 ⟸ ENSMUST00000195515

Protein Domains

EF-hand

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3YUU6-F1-model_v2	AlphaFold	D3YUU6	1-520	view protein structure

RGD ID:

6881466

Promoter ID:

EPDNEW_M4184

Type:

multiple initiation site

Name:

Crnn_1

Description:

Mus musculus cornulin , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	3	93,144,789 - 93,144,849	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000078657	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000107300	ENTREZGENE
	ENSMUST00000107300.7	UniProtKB/TrEMBL
	ENSMUST00000192372.2	UniProtKB/TrEMBL
	ENSMUST00000195515.2	UniProtKB/TrEMBL
Gene3D-CATH	EF-hand	UniProtKB/TrEMBL
InterPro	EF-hand-like_dom	UniProtKB/TrEMBL
	EF_Hand_1_Ca_BS	UniProtKB/TrEMBL
	EF_hand_Ca-bd	UniProtKB/TrEMBL
	S-100_dom	UniProtKB/TrEMBL
	S100_Ca-bd_sub	UniProtKB/TrEMBL
KEGG Report	mmu:381457	UniProtKB/TrEMBL
MGD	MGI:2685861	ENTREZGENE
NCBI Gene	381457	ENTREZGENE
PANTHER	PTHR11639:SF26	UniProtKB/TrEMBL
	S100 CALCIUM-BINDING PROTEIN	UniProtKB/TrEMBL
Pfam	S_100	UniProtKB/TrEMBL
PhenoGen	Crnn	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/TrEMBL
	EF_HAND_2	UniProtKB/TrEMBL
SMART	EFh	UniProtKB/TrEMBL
	S_100	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/TrEMBL
UniProt	A0A0A6YXA1_MOUSE	UniProtKB/TrEMBL
	D3YUU6	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar