Advanced Search (OLGA)

Gene: Gm266 (predicted gene 266) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Gm266

Name:

predicted gene 266

RGD ID:

1619015

MGI Page

MGI

Description:

Predicted to enable GDP binding activity; GTP binding activity; and GTPase activity. Predicted to be involved in Rap protein signal transduction and negative regulation of cell migration. Predicted to be active in plasma membrane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC212539; uncharacterized protein LOC212539

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DIRAS3 (DIRAS family GTPase 3)	HGNC	Treefam
Rattus norvegicus (Norway rat):	Diras3 (DIRAS family GTPase 3)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	DIRAS3 (DIRAS family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC480441 (ras-related protein Rap-2a-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Diras3 (DIRAS family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DIRAS3 (DIRAS family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DIRAS3 (DIRAS family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DIRAS2 (DIRAS family GTPase 2)	HGNC	Treefam
Homo sapiens (human):	DIRAS1 (DIRAS family GTPase 1)	HGNC	Treefam
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Diras3 (DIRAS family GTPase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rap-2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Rap2l	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	111,451,043 - 111,452,257 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	111,451,043 - 111,452,257 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	111,484,609 - 111,485,823 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	111,484,609 - 111,485,823 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	112,722,820 - 112,724,034 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	111,932,419 - 111,933,604 (-)	NCBI		MGSCv36	mm8
Celera	12	112,674,808 - 112,676,022 (-)	NCBI		Celera
Cytogenetic Map	12	F1	NCBI
cM Map	12	61.01	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gm266	Mouse	intellectual disability		ISO	RGD:1343615	8554872	ClinVar Annotator: match by term: Intellectual disability, severe	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gm266	Mouse	hepatocellular carcinoma		ISO	RGD:1343615	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:28284560

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gm266	Mouse	17beta-estradiol	affects expression	ISO	RGD:1343615	6480464	Estradiol affects the expression of DIRAS3 mRNA	CTD	PMID:20106945
Gm266	Mouse	17beta-estradiol	increases expression	ISO	RGD:1343615	6480464	Estradiol results in increased expression of DIRAS3 mRNA	CTD	PMID:36828454
Gm266	Mouse	2-palmitoylglycerol	increases expression	ISO	RGD:1343615	6480464	2-palmitoylglycerol results in increased expression of DIRAS3 mRNA	CTD	PMID:37199045
Gm266	Mouse	aflatoxin B1	affects expression	ISO	RGD:1343615	6480464	Aflatoxin B1 affects the expression of DIRAS3 protein	CTD	PMID:20106945
Gm266	Mouse	alpha-Zearalanol	multiple interactions	ISO	RGD:1565168	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of DIRAS3 mRNA	CTD	PMID:35163327
Gm266	Mouse	Archazolid B	decreases expression	ISO	RGD:1343615	6480464	archazolid B results in decreased expression of DIRAS3 mRNA	CTD	PMID:25218289
Gm266	Mouse	aristolochic acid A	decreases expression	ISO	RGD:1343615	6480464	aristolochic acid I results in decreased expression of DIRAS3 mRNA	CTD	PMID:33212167
Gm266	Mouse	arsenite(3-)	increases methylation	ISO	RGD:1343615	6480464	arsenite results in increased methylation of DIRAS3 promoter	CTD	PMID:23974009
Gm266	Mouse	arsenous acid	decreases expression	ISO	RGD:1343615	6480464	Arsenic Trioxide results in decreased expression of DIRAS3 mRNA	CTD	PMID:26705709
Gm266	Mouse	benzo[a]pyrene	decreases methylation	ISO	RGD:1343615	6480464	Benzo(a)pyrene results in decreased methylation of DIRAS3 exon	CTD	PMID:27901495
Gm266	Mouse	benzo[a]pyrene	decreases expression	ISO	RGD:1343615	6480464	Benzo(a)pyrene results in decreased expression of DIRAS3 mRNA	CTD	PMID:32234424
Gm266	Mouse	benzo[a]pyrene	affects methylation	ISO	RGD:1343615	6480464	Benzo(a)pyrene affects the methylation of DIRAS3 5' UTR; Benzo(a)pyrene affects the methylation of DIRAS3 promoter	CTD	PMID:27901495
Gm266	Mouse	bisphenol A	increases expression	ISO	RGD:1343615	6480464	bisphenol A results in increased expression of DIRAS3 mRNA	CTD	PMID:27685785\|PMID:36828454
Gm266	Mouse	butanal	decreases expression	ISO	RGD:1343615	6480464	butyraldehyde results in decreased expression of DIRAS3 mRNA	CTD	PMID:26079696
Gm266	Mouse	CGP 52608	multiple interactions	ISO	RGD:1343615	6480464	CGP 52608 promotes the reaction [RORA protein binds to DIRAS3 gene]	CTD	PMID:28238834
Gm266	Mouse	Cuprizon	decreases expression	ISO	RGD:1565168	6480464	Cuprizone results in decreased expression of DIRAS3 mRNA	CTD	PMID:26577399\|PMID:27523638
Gm266	Mouse	cyclosporin A	decreases expression	ISO	RGD:1343615	6480464	Cyclosporine results in decreased expression of DIRAS3 mRNA	CTD	PMID:20106945
Gm266	Mouse	diarsenic trioxide	decreases expression	ISO	RGD:1343615	6480464	Arsenic Trioxide results in decreased expression of DIRAS3 mRNA	CTD	PMID:26705709
Gm266	Mouse	dorsomorphin	multiple interactions	ISO	RGD:1343615	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Gm266	Mouse	doxorubicin	decreases expression	ISO	RGD:1565168	6480464	Doxorubicin results in decreased expression of DIRAS3 mRNA	CTD	PMID:32289291
Gm266	Mouse	entinostat	increases expression	ISO	RGD:1343615	6480464	entinostat results in increased expression of DIRAS3 mRNA	CTD	PMID:27188386
Gm266	Mouse	ethanol	increases expression	ISO	RGD:1343615	6480464	Ethanol results in increased expression of DIRAS3 mRNA	CTD	PMID:31059573
Gm266	Mouse	fonofos	increases methylation	ISO	RGD:1343615	6480464	Fonofos results in increased methylation of DIRAS3 promoter	CTD	PMID:22847954
Gm266	Mouse	isotretinoin	decreases expression	ISO	RGD:1343615	6480464	Isotretinoin results in decreased expression of DIRAS3 mRNA	CTD	PMID:20436886
Gm266	Mouse	lithium chloride	increases expression	ISO	RGD:1343615	6480464	Lithium Chloride results in increased expression of DIRAS3 mRNA	CTD	PMID:15711924
Gm266	Mouse	nickel atom	decreases expression	ISO	RGD:1343615	6480464	Nickel results in decreased expression of DIRAS3 mRNA	CTD	PMID:24768652
Gm266	Mouse	O-methyleugenol	decreases expression	ISO	RGD:1343615	6480464	methyleugenol results in decreased expression of DIRAS3 mRNA	CTD	PMID:32234424
Gm266	Mouse	okadaic acid	decreases expression	ISO	RGD:1343615	6480464	Okadaic Acid results in decreased expression of DIRAS3 mRNA	CTD	PMID:38832940
Gm266	Mouse	paracetamol	decreases expression	ISO	RGD:1343615	6480464	Acetaminophen results in decreased expression of DIRAS3 mRNA	CTD	PMID:29067470
Gm266	Mouse	parathion	increases methylation	ISO	RGD:1343615	6480464	Parathion results in increased methylation of DIRAS3 promoter	CTD	PMID:22847954
Gm266	Mouse	PCB138	decreases expression	ISO	RGD:1565168	6480464	2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of DIRAS3 mRNA	CTD	PMID:23829299
Gm266	Mouse	perfluorooctanoic acid	multiple interactions	ISO	RGD:1565168	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of DIRAS3 mRNA	CTD	PMID:35163327
Gm266	Mouse	phenylmercury acetate	increases expression	ISO	RGD:1343615	6480464	Phenylmercuric Acetate results in increased expression of DIRAS3 mRNA	CTD	PMID:26272509
Gm266	Mouse	phenylmercury acetate	multiple interactions	ISO	RGD:1343615	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Gm266	Mouse	S-nitrosoglutathione	increases expression	ISO	RGD:1343615	6480464	S-Nitrosoglutathione results in increased expression of DIRAS3 mRNA	CTD	PMID:38825487
Gm266	Mouse	SB 431542	multiple interactions	ISO	RGD:1343615	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Gm266	Mouse	silicon dioxide	decreases expression	ISO	RGD:1343615	6480464	Silicon Dioxide analog results in decreased expression of DIRAS3 mRNA	CTD	PMID:25895662
Gm266	Mouse	silicon dioxide	increases expression	ISO	RGD:1343615	6480464	Silicon Dioxide analog results in increased expression of DIRAS3 mRNA	CTD	PMID:23806026
Gm266	Mouse	sodium arsenite	decreases expression	ISO	RGD:1343615	6480464	sodium arsenite results in decreased expression of DIRAS3 mRNA	CTD	PMID:25879800\|PMID:29301061
Gm266	Mouse	sodium arsenite	increases expression	ISO	RGD:1343615	6480464	sodium arsenite results in increased expression of DIRAS3 mRNA	CTD	PMID:38568856
Gm266	Mouse	sunitinib	decreases expression	ISO	RGD:1343615	6480464	Sunitinib results in decreased expression of DIRAS3 mRNA	CTD	PMID:31533062
Gm266	Mouse	temozolomide	decreases expression	ISO	RGD:1343615	6480464	Temozolomide results in decreased expression of DIRAS3 mRNA	CTD	PMID:31758290
Gm266	Mouse	terbufos	increases methylation	ISO	RGD:1343615	6480464	terbufos results in increased methylation of DIRAS3 promoter	CTD	PMID:22847954
Gm266	Mouse	trichloroethene	increases expression	ISO	RGD:1565168	6480464	Trichloroethylene results in increased expression of DIRAS3 mRNA	CTD	PMID:33387578
Gm266	Mouse	trichostatin A	increases expression	ISO	RGD:1343615	6480464	trichostatin A results in increased expression of DIRAS3 mRNA	CTD	PMID:23770000
Gm266	Mouse	valproic acid	affects expression	ISO	RGD:1343615	6480464	Valproic Acid affects the expression of DIRAS3 mRNA	CTD	PMID:25979313
Gm266	Mouse	valproic acid	multiple interactions	ISO	RGD:1343615	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Gm266	Mouse	valproic acid	increases expression	ISO	RGD:1343615	6480464	Valproic Acid results in increased expression of DIRAS3 mRNA	CTD	PMID:23179753\|PMID:26272509\|PMID:27188386\|PMID:29154799
Gm266	Mouse	zearalenone	increases expression	ISO	RGD:1343615	6480464	Zearalenone results in increased expression of DIRAS3 mRNA	CTD	PMID:36828454

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gm266	Mouse	negative regulation of cell migration	involved_in	IBA	PANTHER:PTN000631627\|MGI:1921262\|MGI:1919315\|MGI:97855	2290270		GO_Central	GO_REF:0000033
Gm266	Mouse	Rap protein signal transduction	involved_in	IBA	PANTHER:PTN000631627\|MGI:1919315\|MGI:1921262\|MGI:97855	2290270		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gm266	Mouse	plasma membrane	is_active_in	IBA	PANTHER:PTN000631348\|UniProtKB:P11233\|CGD:CAL0000199219\|UniProtKB:O95057\|FB:FBgn0003205\|RGD:620590\|UniProtKB:P01116\|UniProtKB:P01112\|dictyBase:DDB_G0292998\|UniProtKB:P62070\|SGD:S000005042\|RGD:2827\|SGD:S000003384\|MGI:108053\|CGD:CAL0000184093\|SGD:S000005627\|FB:FBgn0015286\|RGD:619851\|UniProtKB:P61225\|UniProtKB:P11234\|dictyBase:DDB_G0293434\|UniProtKB:E9QX28\|UniProtKB:Q9Y3L5\|UniProtKB:Q99578\|UniProtKB:P10114\|dictyBase:DDB_G0291237\|MGI:97852\|MGI:108054\|PomBase:SPAC17H9.09c\|UniProtKB:Q96HU8	2290270		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gm266	Mouse	GDP binding	enables	IBA	PANTHER:PTN000631348\|PomBase:SPAC17H9.09c\|RGD:621840\|UniProtKB:P10301\|UniProtKB:P10114\|RGD:2981\|UniProtKB:Q9Y3L5\|UniProtKB:P01112\|PomBase:SPBC428.16c\|UniProtKB:Q15382\|UniProtKB:P11234\|UniProtKB:P61225\|UniProtKB:P61224\|UniProtKB:P11233	2290270		GO_Central	GO_REF:0000033
Gm266	Mouse	GTP binding	enables	IBA	PANTHER:PTN000631348\|UniProtKB:P01112\|dictyBase:DDB_G0281385\|SGD:S000005042\|UniProtKB:P61224\|UniProtKB:O95057\|UniProtKB:P11233\|MGI:97912\|UniProtKB:Q15382\|MGI:96224\|MGI:108053\|WB:WBGene00002335\|RGD:1359694\|RGD:621840\|UniProtKB:Q92963\|dictyBase:DDB_G0293434\|UniProtKB:Q9Y3L5\|UniProtKB:P61225\|UniProtKB:P11234\|PomBase:SPBC428.16c\|UniProtKB:Q8TAI7\|UniProtKB:Q96HU8\|UniProtKB:P10114\|dictyBase:DDB_G0291237\|PomBase:SPAC17H9.09c\|MGI:108054	2290270		GO_Central	GO_REF:0000033
Gm266	Mouse	GTPase activity	enables	IBA	PANTHER:PTN000631348\|UniProtKB:Q96A58\|MGI:96680\|UniProtKB:Q92963\|PomBase:SPBC428.16c\|CGD:CAL0000181665\|UniProtKB:P11234\|FB:FBgn0015286\|SGD:S000005627\|UniProtKB:Q96HU8\|PomBase:SPAC17H9.09c\|MGI:108054\|UniProtKB:Q12526\|MGI:97852\|UniProtKB:P10114\|SGD:S000005042\|UniProtKB:P62070\|UniProtKB:P01112\|UniProtKB:P01116\|UniProtKB:Q15382\|UniProtKB:P61224\|UniProtKB:P01111\|FB:FBgn0003205\|UniProtKB:O95057\|CGD:CAL0000199219\|UniProtKB:P11233\|CGD:CAL0000184093\|UniProtKB:O14807\|FB:FBgn0041191\|SGD:S000003384\|FB:FBgn0004636\|RGD:621840\|MGI:1927243\|UniProtKB:P10301	2290270		GO_Central	GO_REF:0000033
Gm266	Mouse	protein binding	enables	ISO	UniProtKB:Q6FHY5	9068941	PMID:32296183	IntAct	PMID:32296183
Gm266	Mouse	protein binding	enables	ISO	UniProtKB:P40763	9068941	PMID:21643014	IntAct	PMID:21643014

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:16141072	PMID:16141073	PMID:19501082	PMID:21873635

Gm266
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	111,451,043 - 111,452,257 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	111,451,043 - 111,452,257 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	111,484,609 - 111,485,823 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	111,484,609 - 111,485,823 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	112,722,820 - 112,724,034 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	111,932,419 - 111,933,604 (-)	NCBI		MGSCv36	mm8
Celera	12	112,674,808 - 112,676,022 (-)	NCBI		Celera
Cytogenetic Map	12	F1	NCBI
cM Map	12	61.01	NCBI

DIRAS3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	68,045,962 - 68,050,627 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	68,045,886 - 68,051,717 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	68,511,645 - 68,516,310 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	68,284,233 - 68,289,048 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	68,223,667 - 68,228,481	NCBI
Celera	1	66,802,348 - 66,807,163 (-)	NCBI		Celera
Cytogenetic Map	1	p31.3	NCBI
HuRef	1	66,621,747 - 66,626,564 (-)	NCBI		HuRef
CHM1_1	1	68,627,001 - 68,631,820 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	67,923,423 - 67,928,086 (-)	NCBI		T2T-CHM13v2.0

Diras3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	136,346,157 - 136,347,371 (-)	NCBI		GRCr8
mRatBN7.2	6	130,524,972 - 130,526,186 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	130,524,742 - 130,530,825 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	6	135,938,345 - 135,940,205 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	135,938,935 - 135,939,534 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	144,475,515 - 144,477,379 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	136,245,520 - 136,247,072 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	128,080,876 - 128,082,770 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

DIRAS3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	158,813,884 - 158,825,676 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	157,979,647 - 157,985,477 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	67,283,556 - 67,288,561 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	69,239,462 - 69,244,436 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	69,240,117 - 69,240,806 (-)	Ensembl	panpan1.1		panPan2

LOC480441
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	71,032,087 - 71,033,379 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	70,544,283 - 70,545,574 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	71,309,047 - 71,310,337 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	8	70,972,635 - 70,973,926 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	71,037,280 - 71,038,571 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	71,437,437 - 71,438,728 (-)	NCBI		UU_Cfam_GSD_1.0

Diras3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	80,798,207 - 80,800,867 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936591	3,688,774 - 3,691,342 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DIRAS3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	144,576,342 - 144,578,818 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	144,576,342 - 144,578,820 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	133,865,007 - 133,867,486 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DIRAS3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	65,060,391 - 65,065,165 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	65,063,822 - 65,064,511 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	52,548,119 - 52,553,856 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Gm266
34 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	203
Count of miRNA genes:	168
Interacting mature miRNAs:	187
Transcripts:	ENSMUST00000010673
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
39128213	Lwq23_m	liver weight QTL 10 (mouse)					12	80956708	113383533	Mouse
1300883	Ath21_m	atherosclerosis 21 (mouse)			Not determined		12	85961579	119961683	Mouse
12910532	Nrq10a_m	noise-induced hearing loss resistant QTL 10a (mouse)					12	92750025	120092757	Mouse
12910533	Nrq10_m	noise-induced hearing loss resistant QTL 10 (mouse)					12	92750025	120092757	Mouse
1357463	Vtbt14_m	vertebral trabecular bone trait 14 (mouse)			Not determined		12	92936097	120092757	Mouse
1301269	Sluc12_m	susceptibility to lung cancer 12 (mouse)			Not determined		12	96860337	120092757	Mouse
4142007	Chlq17_m	circulating hormone level QTL 17 (mouse)			Not determined		12	88052874	120092757	Mouse
4141297	Plyid_m	Polymeric IgA dominance (mouse)			Not determined			109183385	115885122	Mouse
1300545	Lifespan3_m	life span 3 (mouse)			Not determined		12	88052874	120092757	Mouse
4141610	Tailaq1_m	tail length adjusted QTL 1 (mouse)			Not determined			80956708	113383533	Mouse
1301836	Heal5_m	wound healing/regeneration 5 (mouse)			Not determined		12	89939031	120092757	Mouse
13524846	Ppiq11_m	prepulse inhibition QTL 11 (mouse)					12	82666396	116666396	Mouse
10412156	Nociq3_m	nociceptive sensitivity inflammatory QTL 3 (mouse)			Not determined		12	86396075	114831653	Mouse
13524842	Ppiq10a_m	prepulse inhibition QTL 10a (mouse)					12	77512220	111512220	Mouse
1301879	Insq10_m	insulin QTL 10 (mouse)			Not determined		12	83532075	117532224	Mouse
10402491	Dipa4_m	drug induced psychomotor activation 4 (mouse)			Not determined		12	91222515	120092757	Mouse
1301492	Dbsty3_m	diabesity 3 (mouse)			Not determined		12	83532075	117532224	Mouse
4141335	W6q10_m	weight 6 weeks QTL 10 (mouse)			Not determined			80956708	113383533	Mouse
5491194	Mobq3_m	multigenic obesity QTL 3 (mouse)			Not determined		12	89664071	120092757	Mouse
1302138	Im6_m	immunoregulatory 6 (mouse)			Not determined		12	96860337	120092757	Mouse
1301308	Prdt4_m	prion disease incubation time 4 (mouse)			Not determined		12	88308354	120092757	Mouse
1301922	Bbaa6_m	B.burgdorferi-associated arthritis 6 (mouse)			Not determined		12	90308268	120092757	Mouse
1302177	Dps2_m	delta power in slow-wave sleep 2 (mouse)			Not determined		12	94146064	120092757	Mouse
10412075	Nils1_m	neointima lesion size 1 (mouse)			Not determined		12	102024665	120092757	Mouse
27226793	Feml10_m	femur length 10, 5 week (mouse)					12	68346774	113363620	Mouse
1558957	Igan4_m	IgA nephropathy 4 (mouse)			Not determined		12	109750025	119024949	Mouse
4142401	Egq10_m	early growth QTL 10 (mouse)			Not determined			80956708	113383533	Mouse
1300973	Abmm_m	antibody mediated myocarditis (mouse)			Not determined		12	93264461	120092757	Mouse
13524849	Ppiq11a_m	prepulse inhibition QTL 11a (mouse)					12	80989143	114989143	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001033248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC122190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK140917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK166394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC145736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC145762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM898567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000010673 ⟹ ENSMUSP00000010673

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	12	111,451,043 - 111,452,257 (-)	Ensembl
GRCm38.p6 Ensembl	12	111,484,609 - 111,485,823 (-)	Ensembl

RefSeq Acc Id:

NM_001033248 ⟹ NP_001028420

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	12	111,451,043 - 111,452,257 (-)	NCBI
GRCm38	12	111,484,609 - 111,485,823 (-)	ENTREZGENE
MGSCv37	12	112,722,820 - 112,724,034 (-)	RGD
Celera	12	112,674,808 - 112,676,022 (-)	RGD
cM Map	12		ENTREZGENE

Sequence:

show sequence

GTCCTCCCCAAGCTGCCTCCCAGCGCCATTCCCCGCGTCCCCTTGTCCGGGCCATGGAGGGCTTAGTGCTGCGCCCCGCCAAAGACTACCGGGTGGTGGTGCTGGGCAGCGTGGCGGTGGGTAAGACG
GCGCTGGCCACGCAGTTCGCGTGCGGCCGCTTCCCCGAGCGCTGCGAGCCGTCGGTGGAGGAGCTGTTCAGCAAGGTGATCGAGGTGAACCGGGCTCCCGCGCTGCTGGAAATCGTGGACACGGTGGG
CGCCGAGCATCTGGTCACCCTCAAAGACCTGTACATCAGGAACAGCGACGGCTTCGTGGTGCTCTACAGCGTGTGCGACGAGGCCTCGTTCCAGGCCGTGCGGCCGCTGCGGGAGCGCATGGGCCGGC
TGCGGGGCTCGCGCGCGGTCCCGCTCGTGCTGGTGGGCACCAAGGCCGACCTAGATGCCGAGCGCCAGGTTCTGACGGCCCAGGGCCGCGCGCTGGCCCGCGAGTGGCGTTGCCCGTTCCTGGAAATC
ACGACCAAGAGCAAAACGATGGTGGACCACGTGTTCACGCAGGTGGTGCGCGAGATGGAGGCCCTGGCCCCGCCGGGACAGGAGGCTCCCCGCATCCCCGCCAACGCCCTGGAGACGTGGCCCGCCGA
GAGGTTCATTGGCTAGCGCGCCACGGTCCGCCGGCTCAGTGCCTTTTCCCAGAAACGTATCCAACAGTGGCTGCTTTTCTGTGTATTCACCGCAAAGGGTGATGGTGCTTCAATCTGCCTGCCTGTCT
TTCTTCAATGTTAGGCAAAAACTTTGCAACATCCCCTCTGTTGACCTCCGACTGTGCTACAAGAAGAAACCAAAATTTACATTTTACCGTAGAGAAAATTTACAGCCCTGTTCAATCTGTTTCGGACT
CCCACCCACCCGTCTAATTTTTGTAAATAGCAACTCGGGAACTTTTGATTGGTTGGGTAGTGTGCACTGATGAAAGGTTTTCTTCAGCTTTAGGACGGTTTTCTCTCCTTTACAGCCTTGAATCCAGC
AGTGAGATTTTCCTCAACATGAATTCCTAAATATAGTTATGACTTATGTCATGTTGGTTTGAAAGGGGATACTGGACGGGAGACAACTGTGCACGCACACTAAGATAGCTCGGCCCTACCTTGTAATT
GACATTTAGTTGGTTTCCACATCCTCTGCATTGGGAATAAAATTAGAAGTTGGTGATTTTTAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001028420	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI45737	(Get FASTA)	NCBI Sequence Viewer
	AAI45763	(Get FASTA)	NCBI Sequence Viewer
	BAE38750	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000010673
	ENSMUSP00000010673.6

RefSeq Acc Id:

NP_001028420 ⟸ NM_001033248

- UniProtKB:

A6H634 (UniProtKB/TrEMBL), Q3TLP2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGLVLRPAKDYRVVVLGSVAVGKTALATQFACGRFPERCEPSVEELFSKVIEVNRAPALLEIVDTVGAEHLVTLKDLYIRNSDGFVVLYSVCDEASFQAVRPLRERMGRLRGSRAVPLVLVGTKADL
DAERQVLTAQGRALAREWRCPFLEITTKSKTMVDHVFTQVVREMEALAPPGQEAPRIPANALETWPAERFIG

hide sequence

Ensembl Acc Id:

ENSMUSP00000010673 ⟸ ENSMUST00000010673

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A6H634-F1-model_v2	AlphaFold	A6H634	1-200	view protein structure

RGD ID:

8679328

Promoter ID:

EPDNEW_M17695

Type:

multiple initiation site

Name:

Gm266_1

Description:

Mus musculus predicted gene 266 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	12	111,485,796 - 111,485,856	EPDNEW

RGD ID:

6822979

Promoter ID:

MM_KWN:12829

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Kidney

Transcripts:

NM_001033248

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	12	112,723,741 - 112,724,292 (-)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000010529	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000010673	ENTREZGENE
	ENSMUST00000010673.7	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/TrEMBL
	Small_GTPase	UniProtKB/TrEMBL
	Small_GTPase_Ras	UniProtKB/TrEMBL
KEGG Report	mmu:212539	UniProtKB/TrEMBL
MGD	MGI:2685112	ENTREZGENE
NCBI Gene	212539	ENTREZGENE
PANTHER	PTHR24070	UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/TrEMBL
PhenoGen	Gm266	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
SMART	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A6H634	ENTREZGENE, UniProtKB/TrEMBL
	Q3TLP2	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD