Symbol:
Apoo
Name:
apolipoprotein O
RGD ID:
1618363
MGI Page
MGI
Description:
Predicted to be involved in cristae formation. Located in mitochondrion. Is expressed in adrenal gland; liver left lobe; and liver right lobe. Orthologous to human APOO (apolipoprotein O).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
0610008C08Rik; 1110019O03Rik; MGC130105; MGC130106; Mico; MICOS complex subunit Mic23; MICOS complex subunit Mic26; Micos26; RP23-272D10.2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
APOO (apolipoprotein O) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Apoo (apolipoprotein O) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Apoo (apolipoprotein O) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
APOO (apolipoprotein O) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
APOO (apolipoprotein O) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Apoo (apolipoprotein O) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
APOO (apolipoprotein O) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
APOO (apolipoprotein O) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Apoo (apolipoprotein O) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Apoo (apolipoprotein O)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
APOO (apolipoprotein O)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
apoob (apolipoprotein O, b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
apooa (apolipoprotein O, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG5903
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
moma-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
apoo
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Related Pseudogenes:
Apoo-ps
Gm17918
Gm17932
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 93,410,615 - 93,460,699 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 93,410,723 - 93,460,699 (+) Ensembl GRCm39 Ensembl GRCm38 X 94,367,010 - 94,417,093 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 94,367,117 - 94,417,093 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 91,612,449 - 91,662,429 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 90,619,873 - 90,669,806 (+) NCBI MGSCv36 mm8 Celera X 81,307,125 - 81,343,955 (+) NCBI Celera Cytogenetic Map X C3 NCBI cM Map X 41.56 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Apoo Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of APOO mRNA CTD PMID:36331819 Apoo Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of APOO mRNA CTD PMID:26682919 Apoo Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of APOO mRNA CTD PMID:22206623 Apoo Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of APOO mRNA CTD PMID:22206623 Apoo Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of APOO mRNA CTD PMID:19484750 Apoo Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of APOO mRNA CTD PMID:24680724 Apoo Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Apoo (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of APOO mRNA CTD PMID:33387578 Apoo Mouse 2-methylcholine affects expression ISO APOO (Homo sapiens) 6480464 beta-methylcholine affects the expression of APOO mRNA CTD PMID:21179406 Apoo Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO APOO (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of APOO mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of APOO mRNA CTD PMID:28628672 Apoo Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of APOO mRNA CTD PMID:39298647 Apoo Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Apoo (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of APOO mRNA CTD PMID:36041667 Apoo Mouse 4,4'-sulfonyldiphenol affects expression ISO APOO (Homo sapiens) 6480464 bisphenol S affects the expression of APOO protein CTD PMID:31945527 Apoo Mouse 4,4'-sulfonyldiphenol increases methylation ISO APOO (Homo sapiens) 6480464 bisphenol S results in increased methylation of APOO gene CTD PMID:31601247 Apoo Mouse 6-propyl-2-thiouracil increases expression ISO Apoo (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of APOO mRNA CTD PMID:30047161 Apoo Mouse acrylamide increases expression ISO APOO (Homo sapiens) 6480464 Acrylamide results in increased expression of APOO mRNA CTD PMID:32763439 Apoo Mouse all-trans-retinoic acid decreases expression ISO APOO (Homo sapiens) 6480464 Tretinoin results in decreased expression of APOO mRNA CTD PMID:33167477 Apoo Mouse alpha-Zearalanol multiple interactions ISO Apoo (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of APOO mRNA CTD PMID:35163327 Apoo Mouse amitrole increases expression ISO Apoo (Rattus norvegicus) 6480464 Amitrole results in increased expression of APOO mRNA CTD PMID:30047161 Apoo Mouse arsane affects methylation ISO APOO (Homo sapiens) 6480464 Arsenic affects the methylation of APOO gene CTD PMID:25304211 Apoo Mouse arsenic atom affects methylation ISO APOO (Homo sapiens) 6480464 Arsenic affects the methylation of APOO gene CTD PMID:25304211 Apoo Mouse atrazine affects methylation ISO Apoo (Rattus norvegicus) 6480464 Atrazine affects the methylation of APOO gene CTD PMID:28931070 and PMID:35440735 Apoo Mouse benzo[a]pyrene increases expression ISO APOO (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of APOO mRNA CTD PMID:21632981 Apoo Mouse benzo[a]pyrene increases methylation ISO APOO (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of APOO exon CTD PMID:27901495 Apoo Mouse benzo[e]pyrene increases methylation ISO APOO (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of APOO intron CTD PMID:30157460 Apoo Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of APOO mRNA CTD PMID:33754040 Apoo Mouse bisphenol A affects expression ISO Apoo (Rattus norvegicus) 6480464 bisphenol A affects the expression of APOO mRNA CTD PMID:25181051 Apoo Mouse bisphenol A multiple interactions ISO Apoo (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of APOO mRNA CTD PMID:36041667 Apoo Mouse bisphenol A decreases methylation ISO APOO (Homo sapiens) 6480464 bisphenol A results in decreased methylation of APOO gene CTD PMID:31601247 Apoo Mouse bisphenol A multiple interactions ISO APOO (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of APOO mRNA CTD PMID:28628672 Apoo Mouse bisphenol F multiple interactions ISO APOO (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of APOO mRNA CTD PMID:28628672 Apoo Mouse bisphenol F multiple interactions ISO Apoo (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of APOO mRNA CTD PMID:36041667 Apoo Mouse buspirone decreases expression ISO Apoo (Rattus norvegicus) 6480464 Buspirone results in decreased expression of APOO mRNA CTD PMID:24136188 Apoo Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Apoo Mouse cisplatin increases expression ISO APOO (Homo sapiens) 6480464 Cisplatin results in increased expression of APOO mRNA CTD PMID:27392435 Apoo Mouse cisplatin multiple interactions ISO APOO (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of APOO mRNA CTD PMID:27392435 Apoo Mouse cocaine increases expression ISO Apoo (Rattus norvegicus) 6480464 Cocaine results in increased expression of APOO protein CTD PMID:25100957 Apoo Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of APOO mRNA CTD PMID:29279043 Apoo Mouse cyclosporin A increases expression ISO APOO (Homo sapiens) 6480464 Cyclosporine results in increased expression of APOO mRNA CTD PMID:25562108 Apoo Mouse dexamethasone multiple interactions ISO APOO (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of APOO mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of APOO mRNA CTD PMID:28628672 Apoo Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of APOO mRNA CTD PMID:22206623 Apoo Mouse glyphosate increases methylation ISO Apoo (Rattus norvegicus) 6480464 Glyphosate results in increased methylation of APOO gene CTD PMID:31011160 Apoo Mouse indometacin multiple interactions ISO APOO (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of APOO mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of APOO mRNA CTD PMID:28628672 Apoo Mouse ivermectin decreases expression ISO APOO (Homo sapiens) 6480464 Ivermectin results in decreased expression of APOO protein CTD PMID:32959892 Apoo Mouse methapyrilene increases methylation ISO APOO (Homo sapiens) 6480464 Methapyrilene results in increased methylation of APOO intron CTD PMID:30157460 Apoo Mouse methimazole increases expression ISO Apoo (Rattus norvegicus) 6480464 Methimazole results in increased expression of APOO mRNA CTD PMID:30047161 Apoo Mouse oxaliplatin multiple interactions ISO Apoo (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of APOO mRNA CTD PMID:25729387 Apoo Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of APOO mRNA CTD PMID:17562736 Apoo Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of APOO mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of APOO mRNA CTD PMID:36331819 Apoo Mouse perfluorooctanoic acid multiple interactions ISO Apoo (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of APOO mRNA CTD PMID:35163327 Apoo Mouse perfluorooctanoic acid increases expression ISO Apoo (Rattus norvegicus) 6480464 perfluorooctanoic acid results in increased expression of APOO protein CTD PMID:34958885 Apoo Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of APOO mRNA CTD PMID:23811191 Apoo Mouse resveratrol multiple interactions ISO APOO (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of APOO mRNA CTD PMID:23557933 Apoo Mouse sodium arsenite decreases expression ISO APOO (Homo sapiens) 6480464 sodium arsenite results in decreased expression of APOO mRNA CTD PMID:38568856 Apoo Mouse sodium arsenite increases expression ISO APOO (Homo sapiens) 6480464 sodium arsenite results in increased expression of APOO mRNA CTD PMID:34032870 Apoo Mouse sulfadimethoxine increases expression ISO Apoo (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of APOO mRNA CTD PMID:30047161 Apoo Mouse sulforaphane increases expression EXP 6480464 sulforaphane results in increased expression of APOO mRNA CTD PMID:30529165 Apoo Mouse sunitinib decreases expression ISO APOO (Homo sapiens) 6480464 Sunitinib results in decreased expression of APOO mRNA CTD PMID:31533062 Apoo Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of APOO gene and titanium dioxide results in increased methylation of APOO promoter CTD PMID:35295148 Apoo Mouse topotecan multiple interactions ISO Apoo (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of APOO mRNA CTD PMID:25729387 Apoo Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of APOO mRNA CTD PMID:33045310 Apoo Mouse tungsten increases expression EXP 6480464 Tungsten results in increased expression of APOO mRNA CTD PMID:30912803 Apoo Mouse valproic acid increases expression ISO APOO (Homo sapiens) 6480464 Valproic Acid results in increased expression of APOO mRNA and Valproic Acid results in increased expression of APOO protein CTD PMID:29154799 and PMID:29501571 Apoo Mouse valproic acid affects expression ISO APOO (Homo sapiens) 6480464 Valproic Acid affects the expression of APOO mRNA CTD PMID:25979313 Apoo Mouse valproic acid decreases methylation ISO APOO (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of APOO gene CTD PMID:29501571 Apoo Mouse vinclozolin decreases methylation ISO Apoo (Rattus norvegicus) 6480464 vinclozolin results in decreased methylation of APOO gene CTD PMID:31682807
Apoo Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 93,410,615 - 93,460,699 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 93,410,723 - 93,460,699 (+) Ensembl GRCm39 Ensembl GRCm38 X 94,367,010 - 94,417,093 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 94,367,117 - 94,417,093 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 91,612,449 - 91,662,429 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 90,619,873 - 90,669,806 (+) NCBI MGSCv36 mm8 Celera X 81,307,125 - 81,343,955 (+) NCBI Celera Cytogenetic Map X C3 NCBI cM Map X 41.56 NCBI
APOO Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 23,833,353 - 23,907,938 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 23,833,353 - 23,907,938 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 23,851,470 - 23,926,055 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 23,761,391 - 23,835,958 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera X 27,970,217 - 28,043,546 (-) NCBI Celera Cytogenetic Map X p22.11 NCBI HuRef X 21,597,250 - 21,670,104 (-) NCBI HuRef CHM1_1 X 23,882,370 - 23,957,282 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 23,417,034 - 23,491,615 (-) NCBI T2T-CHM13v2.0
Apoo Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 63,151,736 - 63,256,696 (+) NCBI GRCr8 mRatBN7.2 X 59,157,971 - 59,262,940 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 59,158,049 - 59,262,940 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 60,611,279 - 60,714,042 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 64,112,402 - 64,215,169 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 61,657,121 - 61,768,684 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 63,521,033 - 63,625,134 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 63,520,991 - 63,625,134 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 64,430,860 - 64,534,961 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 81,784,706 - 81,889,551 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 59,587,672 - 59,692,328 (+) NCBI Celera Cytogenetic Map X q22 NCBI
Apoo Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955509 4,255,030 - 4,325,568 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955509 4,256,834 - 4,325,086 (-) NCBI ChiLan1.0 ChiLan1.0
APOO Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 25,634,548 - 25,708,412 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 25,637,937 - 25,711,738 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 16,432,822 - 16,506,668 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 23,807,998 - 23,879,906 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 23,806,477 - 23,880,518 (-) Ensembl panpan1.1 panPan2
APOO Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 19,501,849 - 19,555,425 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 X 19,456,861 - 19,510,690 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 19,456,893 - 19,510,486 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 19,496,013 - 19,549,863 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 19,529,419 - 19,583,232 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 19,585,588 - 19,639,345 (-) NCBI UU_Cfam_GSD_1.0
Apoo
APOO Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 19,953,158 - 20,017,727 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 19,953,147 - 20,017,784 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 21,323,359 - 21,366,041 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
APOO Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 22,295,822 - 22,377,670 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 22,295,037 - 22,377,668 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666056 24,181,041 - 24,254,590 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Apoo
.
Predicted Target Of
Count of predictions: 254 Count of miRNA genes: 87 Interacting mature miRNAs: 88 Transcripts: ENSMUST00000113895, ENSMUST00000113896, ENSMUST00000113897, ENSMUST00000113898 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
4141630 Gct6_m granulosa cell tumorigenesis 6 (mouse) Not determined 47179121 129764756 Mouse 4141803 Lmr30_m leishmaniasis resistance 30 (mouse) Not determined 85062606 119062720 Mouse 1302054 Gct4_m granulosa cell tumorigenesis 4 (mouse) Not determined X 76124336 102062720 Mouse 13824980 Ferq1_m genetic fertility QTL 1 (mouse) X 54045360 148782996 Mouse 11075102 Modc2_m modifier of Odc2 (mouse) X 80189914 114190059 Mouse 1357500 Mdmsc6_m modifier of muscularity 6 (mouse) Not determined X 75306671 109306758 Mouse 12879918 Shm4_m sperm head morphology 4 (mouse) X 72072050 102062720 Mouse 25314318 Sccor2_m synaptonemal complex length to mean MLH1 count ratio 2 (mouse) X 70543606 96543606 Mouse 1357433 Dbts2_m diabetes 2 (mouse) Not determined X 7226295 150107038 Mouse 4141665 Mhysq2_m male hybrid sterility QTL 2 (mouse) Not determined 71453852 139203212 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000113895 ⟹ ENSMUSP00000109528
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 93,410,789 - 93,460,699 (+) Ensembl GRCm38.p6 Ensembl X 94,367,183 - 94,417,093 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000113896 ⟹ ENSMUSP00000109529
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 93,410,771 - 93,460,699 (+) Ensembl GRCm38.p6 Ensembl X 94,367,165 - 94,417,093 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000113897 ⟹ ENSMUSP00000109530
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 93,410,760 - 93,460,699 (+) Ensembl GRCm38.p6 Ensembl X 94,367,154 - 94,417,093 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000113898 ⟹ ENSMUSP00000109531
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 93,410,723 - 93,460,567 (+) Ensembl GRCm38.p6 Ensembl X 94,367,117 - 94,416,961 (+) Ensembl
RefSeq Acc Id:
NM_001199337 ⟹ NP_001186266
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 93,410,760 - 93,460,699 (+) NCBI GRCm38 X 94,367,154 - 94,417,093 (+) NCBI Celera X 81,307,127 - 81,343,958 (+) ENTREZGENE cM Map X ENTREZGENE
Sequence:
ATGTTCAAGGTGAGAATGTGGAGCCGGGTCACAGCTGTCATTGTCCCCTCTCAGCCTCCAGGAGCCCTCCCCACGCTCCCGGGCGTCTTTTTGGGGACCAGACTCGGTTCCTCCTGAGGCCTTTTTCA
hide sequence
RefSeq Acc Id:
NM_001199338 ⟹ NP_001186267
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 93,410,760 - 93,460,699 (+) NCBI GRCm38 X 94,367,154 - 94,417,093 (+) NCBI Celera X 81,307,127 - 81,343,958 (+) ENTREZGENE cM Map X ENTREZGENE
Sequence:
ATGTTCAAGGTGAGAATGTGGAGCCGGGTCACAGCTGTCATTGTCCCCTCTCAGCCTCCAGGAGCCCTCCCCACGCTCCCGGGCGTCTTTTTGGGGACCAGACTCGGTTCCTCCTGAGGCCTTTTTCA
hide sequence
RefSeq Acc Id:
NM_001199339 ⟹ NP_001186268
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 93,410,760 - 93,460,699 (+) NCBI GRCm38 X 94,367,154 - 94,417,093 (+) NCBI Celera X 81,307,127 - 81,343,958 (+) ENTREZGENE cM Map X ENTREZGENE
Sequence:
ATGTTCAAGGTGAGAATGTGGAGCCGGGTCACAGCTGTCATTGTCCCCTCTCAGCCTCCAGGAG
hide sequence
RefSeq Acc Id:
NM_026673 ⟹ NP_080949
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 93,410,716 - 93,460,699 (+) NCBI GRCm38 X 94,367,110 - 94,417,093 (+) NCBI MGSCv37 X 91,612,449 - 91,662,429 (+) RGD Celera X 81,307,127 - 81,343,958 (+) ENTREZGENE cM Map X ENTREZGENE
Sequence:
GCCAAGGGAGGGGTGACCCTGCCGGAGCCGCGGCTGCCAGCGACATGTTCAAGGTAATTCAGAGATCTGTGGGGCCAGCCAGCCTGAGCCTGCTCACCTTCAGAGTCTATGCAGCACCCAAAAAGGAC
hide sequence
RefSeq Acc Id:
XM_011247666 ⟹ XP_011245968
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 93,410,615 - 93,446,110 (+) NCBI GRCm38 X 94,367,010 - 94,402,504 (+) NCBI
Sequence:
CGGGTTAAGCTGGCGTCACAGCATCATCTCGTGCTCGCTCGTGGTCAAGGGAATCAGGATCTAA
hide sequence
RefSeq Acc Id:
XM_011247667 ⟹ XP_011245969
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 93,410,764 - 93,446,104 (+) NCBI GRCm38 X 94,367,154 - 94,402,495 (+) NCBI
Sequence:
TCAAGGTGAGAATGTGGAGCCGGGTCACAGCTGTCATTGTCCCCTCTCAGCCTCCAGGAGCCCT
hide sequence
RefSeq Acc Id:
XM_011247668 ⟹ XP_011245970
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 93,410,760 - 93,446,104 (+) NCBI GRCm38 X 94,367,154 - 94,402,495 (+) NCBI
Sequence:
ATGTTCAAGGTGAGAATGTGGAGCCGGGTCACAGCTGTCATTGTCCCCTCTCAGCCTCCAGGAGCCCTCCCCACGCTCCCGGGCGTCTTTTTGGGGACCAGACTCGGTTCCTCCTGAGGCCTTTTTCA
hide sequence
RefSeq Acc Id:
XM_011247669 ⟹ XP_011245971
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 93,410,772 - 93,446,104 (+) NCBI GRCm38 X 94,367,169 - 94,402,495 (+) NCBI
Sequence:
AGAATGTGGAGCCGGGTCACAGCTGTCATTGTCCCCTCTCAGCCTCCAGGAGCCCTCCCCACGC
hide sequence
RefSeq Acc Id:
NP_080949 ⟸ NM_026673
- Peptide Label:
isoform 1 precursor
- UniProtKB:
B1ASQ3 (UniProtKB/Swiss-Prot), B1ASQ2 (UniProtKB/Swiss-Prot), Q9D186 (UniProtKB/Swiss-Prot), Q9DCZ4 (UniProtKB/Swiss-Prot), Q3KNM9 (UniProtKB/TrEMBL)
- Sequence:
MFKVIQRSVGPASLSLLTFRVYAAPKKDSPHKSYMKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFA
hide sequence
RefSeq Acc Id:
NP_001186266 ⟸ NM_001199337
- Peptide Label:
isoform 2
- UniProtKB:
Q9DCZ4 (UniProtKB/Swiss-Prot)
- Sequence:
MPFWGCGEDEARSGRCRVIQRSVGPASLSLLTFRVYAAPKKDSPHKSYMKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRL
hide sequence
RefSeq Acc Id:
NP_001186268 ⟸ NM_001199339
- Peptide Label:
isoform 3
- UniProtKB:
Q3KNM9 (UniProtKB/TrEMBL)
- Sequence:
MKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFARGSKIKKLVYPPFFMGLGASVYYPQQAITIAQIT
hide sequence
RefSeq Acc Id:
NP_001186267 ⟸ NM_001199338
- Peptide Label:
isoform 3
- UniProtKB:
Q3KNM9 (UniProtKB/TrEMBL)
- Sequence:
MKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVD
hide sequence
RefSeq Acc Id:
XP_011245968 ⟸ XM_011247666
- Peptide Label:
isoform X1
- Sequence:
MFKVIQRSVGPASLSLLTFRVYAAPKKDSPHKSYMKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFA
hide sequence
RefSeq Acc Id:
XP_011245970 ⟸ XM_011247668
- Peptide Label:
isoform X2
- Sequence:
MKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFARGSKIKKLVYPPFFMGLGASVYYPQQAITIAQIT
hide sequence
RefSeq Acc Id:
XP_011245971 ⟸ XM_011247669
- Peptide Label:
isoform X2
- Sequence:
MKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFARGSKIKKLVYPPFFMGLGASVYYPQQAITIAQIT
hide sequence
RefSeq Acc Id:
XP_011245969 ⟸ XM_011247667
- Peptide Label:
isoform X2
- Sequence:
MKIDELSLYSVPEGQSKYVEEPRTQLEENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFAGFVGLLFARGSKIKKLVYPPFFMGLGASVYYPQQAITIAQIT
hide sequence
Ensembl Acc Id:
ENSMUSP00000109529 ⟸ ENSMUST00000113896
Ensembl Acc Id:
ENSMUSP00000109528 ⟸ ENSMUST00000113895
Ensembl Acc Id:
ENSMUSP00000109531 ⟸ ENSMUST00000113898
Ensembl Acc Id:
ENSMUSP00000109530 ⟸ ENSMUST00000113897
RGD ID: 6845487 Promoter ID: MM_KWN:61166 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000044989, ENSMUST00000113895, ENSMUST00000113896, NM_026673, NR_004438, OTTMUST00000043748 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 91,611,476 - 91,612,652 (+) MPROMDB
RGD ID: 13680948 Promoter ID: EPDNEW_M24623 Type: multiple initiation site Name: Apoo_1 Description: Mus musculus apolipoprotein O , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 X 94,367,124 - 94,367,184 EPDNEW
