Advanced Search (OLGA)

Gene: Krt31 (keratin 31) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Krt31

Name:

keratin 31

RGD ID:

1615966

MGI Page

MGI

Description:

Predicted to enable structural molecule activity. Predicted to be involved in epithelial cell differentiation and intermediate filament organization. Predicted to be located in intermediate filament. Predicted to be active in cytoskeleton. Is expressed in hair cortex; hair cuticle; hair outer root sheath; and skin. Orthologous to human KRT31 (keratin 31) and KRT33A (keratin 33A).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Ha; Ha1; hair keratin, type I Ha1; HKA-1; K31; keratin complex 1, acidic, gene 1; keratin complex 1, gene 1; keratin, type I cuticular Ha1; keratin-31; Kha; Kha1; Krt1-; Krt1-1; MKHA-; MKHA-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KRT31 (keratin 31)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Krt31 (keratin 31)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100971782 (keratin, type I cuticular Ha1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KRT34 (keratin 34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KRT31 (keratin 31)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KRT33A (keratin 33A)	HGNC	Ensembl, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Homo sapiens (human):	KRT33B (keratin 33B)	HGNC	OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Homo sapiens (human):	KRT34 (keratin 34)	HGNC	OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Alliance orthologs ³
Homo sapiens (human):	KRT31 (keratin 31)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Krt31 (keratin 31)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	krtt1c19e (keratin type 1 c19e)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	cyt1 (type I cytokeratin, enveloping layer)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt1-19d (keratin, type 1, gene 19d)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt93 (keratin 93)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt92 (keratin 92)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt94 (keratin 94)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt97 (keratin 97)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	cyt1l (type I cytokeratin, enveloping layer, like)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt91 (keratin 91)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt17 (keratin 17)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt96 (keratin 96)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	krt15 (keratin 15)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	ouro2	Alliance	DIOPT (Ensembl Compara\|PANTHER)

Related Pseudogenes:

Krt31-ps

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	99,937,472 - 99,941,377 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	99,937,472 - 99,941,377 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	100,046,646 - 100,050,551 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	100,046,646 - 100,050,551 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	99,907,960 - 99,911,865 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	99,862,736 - 99,866,641 (-)	NCBI		MGSCv36	mm8
Celera	11	110,662,987 - 110,666,881 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	63.39	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Krt31	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	KRT31 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of KRT31 mRNA	CTD	PMID:23152189
Krt31	Mouse	2-bromohexadecanoic acid	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT31 protein]	CTD	PMID:38195004
Krt31	Mouse	2-hydroxypropanoic acid	decreases expression	ISO	KRT31 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of KRT31 mRNA	CTD	PMID:30851411
Krt31	Mouse	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of KRT31 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of KRT31 mRNA	CTD	PMID:28628672
Krt31	Mouse	4-hydroxyphenyl retinamide	decreases expression	EXP		6480464	Fenretinide results in decreased expression of KRT31 mRNA	CTD	PMID:28973697
Krt31	Mouse	alpha-Zearalanol	decreases expression	ISO	Krt31 (Rattus norvegicus)	6480464	Zeranol results in decreased expression of KRT31 mRNA	CTD	PMID:35163327
Krt31	Mouse	alpha-Zearalanol	multiple interactions	ISO	Krt31 (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of KRT31 mRNA	CTD	PMID:35163327
Krt31	Mouse	atrazine	increases expression	ISO	KRT31 (Homo sapiens)	6480464	Atrazine results in increased expression of KRT31 mRNA	CTD	PMID:22378314
Krt31	Mouse	benzo[a]pyrene	increases methylation	ISO	KRT31 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of KRT31 exon and Benzo(a)pyrene results in increased methylation of KRT31 promoter	CTD	PMID:27901495
Krt31	Mouse	beta-naphthoflavone	increases expression	ISO	KRT31 (Homo sapiens)	6480464	beta-Naphthoflavone results in increased expression of KRT31 mRNA	CTD	PMID:32151702
Krt31	Mouse	bis(2-ethylhexyl) phthalate	decreases expression	ISO	KRT31 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of KRT31 mRNA	CTD	PMID:31163220
Krt31	Mouse	bisphenol A	decreases expression	ISO	Krt31 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of KRT31 mRNA	CTD	PMID:25181051
Krt31	Mouse	bisphenol A	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of KRT31 mRNA and [Phenolsulfonphthalein deficiency co-treated with bisphenol A] results in increased expression of KRT31 protein	CTD	PMID:28628672 and PMID:31629898
Krt31	Mouse	bisphenol A	increases methylation	ISO	Krt31 (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of KRT31 gene	CTD	PMID:28505145
Krt31	Mouse	bisphenol A	multiple interactions	ISO	Krt31 (Rattus norvegicus)	6480464	[bisphenol A co-treated with Genistein] results in increased methylation of KRT31 gene	CTD	PMID:28505145
Krt31	Mouse	bisphenol F	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of KRT31 mRNA	CTD	PMID:28628672
Krt31	Mouse	cadmium atom	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT31 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT31 protein	CTD	PMID:38195004
Krt31	Mouse	cadmium dichloride	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT31 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT31 protein	CTD	PMID:38195004
Krt31	Mouse	carbon nanotube	decreases expression	EXP		6480464	Nanotubes and Carbon analog results in decreased expression of KRT31 mRNA	CTD	PMID:25620056
Krt31	Mouse	carmustine	decreases expression	ISO	KRT31 (Homo sapiens)	6480464	Carmustine results in decreased expression of KRT31 mRNA	CTD	PMID:15980968
Krt31	Mouse	CGP 52608	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to KRT31 gene]	CTD	PMID:28238834
Krt31	Mouse	dexamethasone	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of KRT31 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of KRT31 mRNA	CTD	PMID:28628672
Krt31	Mouse	folic acid	decreases expression	EXP		6480464	Folic Acid results in decreased expression of KRT31 mRNA	CTD	PMID:25629700
Krt31	Mouse	genistein	multiple interactions	ISO	Krt31 (Rattus norvegicus)	6480464	[bisphenol A co-treated with Genistein] results in increased methylation of KRT31 gene	CTD	PMID:28505145
Krt31	Mouse	indometacin	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of KRT31 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of KRT31 mRNA	CTD	PMID:28628672
Krt31	Mouse	leflunomide	increases expression	ISO	KRT31 (Homo sapiens)	6480464	leflunomide results in increased expression of KRT31 mRNA	CTD	PMID:28988120
Krt31	Mouse	perfluorooctanoic acid	multiple interactions	ISO	Krt31 (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of KRT31 mRNA	CTD	PMID:35163327
Krt31	Mouse	phenol red	multiple interactions	ISO	KRT31 (Homo sapiens)	6480464	[Phenolsulfonphthalein deficiency co-treated with bisphenol A] results in increased expression of KRT31 protein	CTD	PMID:31629898
Krt31	Mouse	rac-lactic acid	decreases expression	ISO	KRT31 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of KRT31 mRNA	CTD	PMID:30851411
Krt31	Mouse	rotenone	decreases expression	ISO	KRT31 (Homo sapiens)	6480464	Rotenone results in decreased expression of KRT31 mRNA	CTD	PMID:29955902
Krt31	Mouse	tetraphene	increases expression	EXP		6480464	benz(a)anthracene results in increased expression of KRT31 mRNA	CTD	PMID:26377693

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Krt31	Mouse	epithelial cell differentiation	involved_in	IBA	PANTHER:PTN008383948 more ...	2290270		GO_Central	GO_REF:0000033
Krt31	Mouse	intermediate filament organization	involved_in	IBA	PANTHER:PTN008383948 more ...	2290270		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Krt31	Mouse	cytoskeleton	is_active_in	IBA	PANTHER:PTN001905729 more ...	2290270		GO_Central	GO_REF:0000033
Krt31	Mouse	intermediate filament	located_in	IEA	UniProtKB-KW:KW-0403 and UniProtKB-KW:KW-0416	2290270		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:Q99572 more ...	9068941	PMID:32296183	IntAct	PMID:32296183
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:A0A1B0GWI1 more ...	9068941	PMID:25416956	IntAct	PMID:25416956
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:P0DTD1-PRO_0000449633	9068941	PMID:36217029	IntAct	PMID:36217029
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:Q8IYX8-2 more ...	9068941	PMID:25416956	IntAct	PMID:25416956
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:A0A1B0GWI1 more ...	9068941	PMID:32296183	IntAct	PMID:32296183
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:P02538 more ...	9068941	PMID:25910212	IntAct	PMID:25910212
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:Q14005-2 more ...	9068941	PMID:32296183	IntAct	PMID:32296183
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:P07510 more ...	9068941	PMID:29892012	IntAct	PMID:29892012
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:A0A0S2Z4D9 more ...	9068941	PMID:26871637	IntAct	PMID:26871637
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:O95863 and UniProtKB:P49639	9068941	PMID:31515488	IntAct	PMID:31515488
Krt31	Mouse	protein binding	enables	ISO	UniProtKB:O14964 more ...	9068941	PMID:33961781	IntAct	PMID:33961781
Krt31	Mouse	structural molecule activity	enables	IEA	InterPro:IPR002957	2290270		InterPro	GO_REF:0000002

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Krt31	Mouse	abnormal coat appearance		IEA		5509061		MGI

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1717610	PMID:2461417	PMID:9882493	PMID:9932492	PMID:10087197	PMID:10227293	PMID:10559501	PMID:10571739	PMID:11125038	PMID:16462742	PMID:16831889	PMID:17991461
PMID:18692037	PMID:19470461	PMID:20106865	PMID:21267068	PMID:21677750	PMID:21873635	PMID:22144916	PMID:22241839	PMID:23271346	PMID:24706781	PMID:28378742	PMID:30973865
PMID:32325033	PMID:38355793

Krt31
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	99,937,472 - 99,941,377 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	99,937,472 - 99,941,377 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	100,046,646 - 100,050,551 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	100,046,646 - 100,050,551 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	99,907,960 - 99,911,865 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	99,862,736 - 99,866,641 (-)	NCBI		MGSCv36	mm8
Celera	11	110,662,987 - 110,666,881 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	63.39	NCBI

KRT31
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	41,393,721 - 41,397,608 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	41,393,721 - 41,397,608 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	39,549,973 - 39,553,860 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	36,803,502 - 36,807,370 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	36,803,501 - 36,807,370	NCBI
Celera	17	36,203,187 - 36,207,055 (-)	NCBI		Celera
Cytogenetic Map	17	q21.2	NCBI
HuRef	17	35,313,475 - 35,317,343 (-)	NCBI		HuRef
CHM1_1	17	39,785,320 - 39,789,188 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	42,249,250 - 42,253,137 (-)	NCBI		T2T-CHM13v2.0

Krt31
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	85,479,533 - 85,483,300 (-)	NCBI		GRCr8
mRatBN7.2	10	84,979,393 - 84,982,898 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	84,979,352 - 84,982,832 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	89,997,662 - 90,001,141 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	89,495,805 - 89,499,280 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	84,887,773 - 84,891,252 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	87,959,123 - 87,962,891 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	87,959,408 - 87,962,846 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	87,745,462 - 87,749,175 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	88,982,495 - 88,985,932 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	88,996,864 - 89,000,302 (-)	NCBI
Celera	10	83,699,202 - 83,702,624 (-)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

LOC100971782
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	23,585,941 - 23,591,143 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	25,475,917 - 25,481,118 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	15,918,837 - 15,923,098 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	16,136,757 - 16,140,608 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	16,136,757 - 16,140,608 (+)	Ensembl	panpan1.1		panPan2

KRT34
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	21,377,218 - 21,381,019 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	21,377,264 - 21,380,088 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	20,838,959 - 20,842,756 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	22,098,159 - 22,101,956 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	22,098,153 - 22,101,234 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	20,884,135 - 20,887,932 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	21,150,133 - 21,153,930 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	21,253,934 - 21,257,731 (+)	NCBI		UU_Cfam_GSD_1.0

KRT31
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	64,835,642 - 64,840,346 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666077	35,680,666 - 35,685,133 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Krt31
182 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	171
Count of miRNA genes:	156
Interacting mature miRNAs:	162
Transcripts:	ENSMUST00000007318
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
27226783	Tibl5_m	tibia length 5, 5 week (mouse)					11	68190826	101890826	Mouse
1302034	Pkccl_m	protein kinase C content in lungs (mouse)			Not determined		11	91604608	121973369	Mouse
1300628	Lgth6_m	body length 6 (mouse)			Not determined		11	66733420	100733652	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44630038	113058009	Mouse
1558812	Rafar_m	retinoic acid induced forelimb autopod reduction (mouse)			Not determined		11	70691198	104691366	Mouse
1301535	Pas5b_m	pulmonary adenoma susceptibility 5b (mouse)			Not determined		11	96176465	108806384	Mouse
1300766	Skull16_m	skull morphology 16 (mouse)			Not determined		11	81574481	115574636	Mouse
1301404	Sbmd4_m	spinal bone mineral density 4 (mouse)			Not determined		11	72019649	106019734	Mouse
12910539	Sstapa3_m	suseptibility to Staphylococcus aureus infection 3 (mouse)					11	96897693	110603991	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56864027	114157957	Mouse
27226758	Femd3_m	femur midshaft diameter 3, 5 week (mouse)					11	80890826	101890826	Mouse
14747003	Mancz9_m	mandible centroid size 9 (mouse)					11	85844911	119844911	Mouse
1301640	Lore4_m	loss of righting induced by ethanol 4 (mouse)			Not determined		11	79156009	107616472	Mouse
10412288	Carg4_m	Candida albicans resistance gene 4 (mouse)			Not determined		11	81810267	115810267	Mouse
11251723	Ewc5_m	ethanol withdrawal and consumption 5 (mouse)					11	89869251	121973369	Mouse
1301681	Sle13_m	systematic lupus erythematosus susceptibility 13 (mouse)			Not determined		11	70691198	104691366	Mouse
1300784	Prdt3_m	prion disease incubation time 3 (mouse)			Not determined		11	66733420	100733652	Mouse
4141339	Nilac2_m	nicotine induced locomotor activity 2 (mouse)			Not determined		11	70691198	104691366	Mouse
10413882	Moe1_m	modifier of epilepsy 1 (mouse)					11	77770978	111771099	Mouse
4141465	Dbm2_m	diabetes modifier 2 (mouse)			Not determined			94437183	118022724	Mouse
10045617	Heal26_m	wound healing/regeneration 26 (mouse)			Not determined		11	92939373	112544554	Mouse
10045616	Heal25_m	wound healing/regeneration 25 (mouse)			Not determined		11	77437183	111437322	Mouse
1357631	Motr1_m	modifier of tubby retinal degeneration 1 (mouse)			Not determined		11	87691198	103274115	Mouse
1301310	Tmevd5_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse)			Not determined		11	72726125	106726289	Mouse
4142348	Pstc2_m	periosteal circumference 2 (mouse)			Not determined		11	72818615	106818733	Mouse
1301414	Heal10_m	wound healing/regeneration 10 (mouse)			Not determined		11	77437183	111437322	Mouse
1300651	Pcyts3_m	plasmacytoma susceptibility 3 (mouse)			Not determined		11	70691198	104691366	Mouse
1301546	Pcir2_m	periosteal circumference 2 (mouse)			Not determined		11	66733420	100733652	Mouse
1300649	Crhq1_m	compensatory renal hypertrophy QTL 1 (mouse)			Not determined		11	81574481	115574636	Mouse
27226789	Feml16_m	femur length 16, 10 week (mouse)					11	87490826	121873369	Mouse
14746970	Manh71_m	mandible shape 71 (mouse)					11	79416257	113416257	Mouse
10043865	T2dm5sa_m	type 2 diabetes mellitus 5 in SMXA RI mice (mouse)			Not determined		11	79813759	104502698	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
10043866	Adip19_m	adiposity 19 (mouse)			Not determined		11	72818615	106818733	Mouse
1301072	Eae22_m	experimental allergic encephalomyelitis 22 (mouse)			Not determined		11	82377698	116377820	Mouse
1300944	Alcp20_m	alcohol preference locus 20 (mouse)			Not determined		11	95403965	121973369	Mouse
4141939	Pregq2_m	pregnancy QTL 2 (mouse)			Not determined		11	94063779	118022724	Mouse
1301983	Berr2_m	berghei resistance locus 2 (mouse)			Not determined		11	98352609	121973369	Mouse
11038695	Par8_m	pulmonary adenoma resistance 8 (mouse)					11	77063779	111063918	Mouse
10043976	Obq33_m	obesity QTL 33 (mouse)			Not determined		11	98500469	121973369	Mouse
1357766	Si5lq6_m	serum IGFBP-5 level QTL 6 (mouse)			Not determined		11	66733420	100733652	Mouse
1301057	Nidd4_m	non-insulin-dependent diabetes mellitus 4 (mouse)			Not determined		11	96810136	121973369	Mouse
1301958	Alcp18_m	alcohol preference locus 18 (mouse)			Not determined		11	95403965	121973369	Mouse
1301833	Tbbmd5_m	total body bone mineral density 5 (mouse)			Not determined		11	66733420	100733652	Mouse
15014785	Mvlq1_m	macrovesicular liver lesion QTL 1 (mouse)					11	86608320	120608320	Mouse
4141012	Femwf6_m	femur work to failure 6 (mouse)			Not determined			66733420	100733652	Mouse
15039374	Adip29_m	adiposity 29 (mouse)					11	86608320	120608320	Mouse
13513918	Heal55_m	wound healing/ regeneration 55 (mouse)					11	99672251	100232454	Mouse
1300962	Cd8mts4_m	CD8 memory T cell subset 4 (mouse)			Not determined		11	96137674	121973369	Mouse
1301095	El6_m	epilepsy 6 (mouse)			Not determined		11	93229183	121973369	Mouse
27226731	Tibmd4_m	tibia midshaft diameter 4, 10 week (mouse)					11	94190826	118890826	Mouse
27226730	Tibmd1_m	tibia midshaft diameter 1, 5 week (mouse)					11	62590826	109390826	Mouse
15039376	Bw42_m	body weight QTL 42 (mouse)					11	86608320	120608320	Mouse
1558753	Ath19_m	atherosclerosis 19 (mouse)			Not determined		11	91604608	121973369	Mouse
10044001	Alcw8_m	alcohol withdrawal 8 (mouse)			Not determined		11	99254187	121973369	Mouse
10044007	Hbnr14_m	Heligmosomoides bakeri nematode resistance 14 (mouse)			Not determined		11	87502600	121502698	Mouse

D11Mit123.3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	100,050,659 - 100,050,887	UniSTS	GRCm38
MGSCv37	11	99,911,973 - 99,912,201	UniSTS	GRCm37
Celera	11	110,666,989 - 110,667,217	UniSTS
Cytogenetic Map	11	D	UniSTS
cM Map	11	58.0	UniSTS
cM Map	11		UniSTS
Whitehead_YAC	11		UniSTS

D11Mit123

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	100,050,723 - 100,051,036	UniSTS	GRCm38
MGSCv37	11	99,912,037 - 99,912,350	UniSTS	GRCm37
Celera	11	110,667,053 - 110,667,366	UniSTS
Cytogenetic Map	11	D	UniSTS
cM Map	11	58.0	UniSTS
Whitehead Genetic	11	62.3	UniSTS

M27734

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	100,046,788 - 100,046,869	UniSTS	GRCm38
MGSCv37	11	99,908,102 - 99,908,183	UniSTS	GRCm37
Celera	11	110,663,129 - 110,663,210	UniSTS
Cytogenetic Map	11	D	UniSTS
cM Map	11	58.3	UniSTS
Whitehead/MRC_RH	11	1330.13	UniSTS

D11Dcr21

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	100,050,877 - 100,051,021	UniSTS	GRCm38
MGSCv37	11	99,912,191 - 99,912,335	UniSTS	GRCm37
Celera	11	110,667,207 - 110,667,351	UniSTS
Cytogenetic Map	11	D	UniSTS
cM Map	11		UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_010659	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AL592545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M27734	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M77350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000007318 ⟹ ENSMUSP00000007318

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	99,937,472 - 99,941,377 (-)	Ensembl
GRCm38.p6 Ensembl	11	100,046,646 - 100,050,551 (-)	Ensembl

RefSeq Acc Id:

NM_010659 ⟹ NP_034789

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	99,937,472 - 99,941,377 (-)	NCBI
GRCm38	11	100,046,646 - 100,050,551 (-)	ENTREZGENE
MGSCv37	11	99,907,960 - 99,911,865 (-)	RGD
Celera	11	110,662,987 - 110,666,881 (-)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

AGAGCTCTGAGGCTTGGAGAATTCACACCGAGTCTTCAGCCAGGTACCTCTCTCCCTCCCTCCAGCACCATGCCATACAATTGCTGCCTGCCGGCCCTGAGCTGCCGCACCAGCTGCTCCTCCCGGCC
CTGTGTGCCCCCCAGCTGCCATGGCTGCACCCTGCCTGGGGCCTGCAACATCCCCGCCAATGTGGGCAACTGCAATTGGTTCTGTGAGGGCTCCTTCAATGGCAATGAGAAGGAGACCATGCAGTTCC
TGAATGACCGCCTGGCCTCCTATATGGAGAAGGTGAGGCAGCTGGAGAGAGAGAATGCAGAGCTGGAATGTAGGATCCAGGAGAGGAACCAGCAGCAGGACCCCCTGGTGTGTCCTGCCTACCAGGCC
TACTTCAGGACCATTGAGGAGTTGCAGCAGAAGATCCTGTGCAGCAAATCAGAGAATGCCAGGTTGGTGGTGCAGATAGATAATGCCAAGCTGGCTGCAGACGACTTCAGGACCAAGTATGAGACAGA
GCTCGGTCTGCGGCAGCTGGTAGAGTCAGACATCAACGGCCTGCGAAGGATCTTGGATGAGCTGACCCTGTGCAAGTCTGACCTGGAGGCGCAGGTGGAGTCCCTGAAGGAGGAGCTGCTGTGTCTCA
AGAGGAACCATGAAGAGGAAGTCAACACCCTACGCTGCCAGCTTGGAGACCGCCTCAACGTGGAGGTGGACGCTGCTCCCACCGTGGACCTGAACCGTGTGCTCAACGAGACCAGGTGTCAGTACGAG
GCCATGGTGGAAACCAACCGCCGGGAAGTGGAGGAATGGTTCACCACACAGACAGAGGAGCTGAACAAGCAGGTGGTGTCCAGCTCAGAGCAGCTGCAGTCCTGCCAAGCCGAGATCATCGAGCTGAG
ACGCACAGTCAACGCCCTGGAGATCGAGCTGCAGGCCCAGCACTGCATGAGAAACTCTCTGGAGAACACCCTGACAGAGAGTGAGGCTCGCTACAGCTCTCAGCTGTCCCAGGTGCAGTGCCTGATCA
CCAACGTGGAGTCCCAGCTTGGTGAGATCCGGGCTGACCTGGAGCGTCAGAACCAGGAGTACCAGGTGCTGCTGGATGTCAAGGCCCGGCTGGAGTGTGAGATCAACACGTATAGGGGCCTGCTGGAG
AGCGAGGACTGCAAGCTACCTTGCAACCCCTGTGCCACAAGCAATGCATGCGGCAAGCCCATTGGGCCCTGCGTCTCCAATCCCTGTGTCCCCTGCCCACCCCCTGCCCCTTGCACACCTTGTGTCCC
ACGTCCCCGCTGTGGGCCATGCAACTCCTTTGTACGCTAGAACCTGGGGGATGTCAACAGAGCAAGGACACTGGGCTTAGCACTCCAGATGGCTGACCTGGTTCTGGTTCCACAAAAACAGACGTAAA
ACCCACAAACCTAATGGCCAGAGCATCTCTGGGATGACAGTCCCAGAATCTGTGTCTTCAGCCACTGCACCCTCCTCCAGGCCATTCTCTGCCTGCCTCCTATTCTTCATTGGACTGCTCAGAGGACT
CTGAAGTGCCAGTGGCCCTCCCTTGTAATCTCCCAATAAACATTT

hide sequence


Protein RefSeqs	NP_034789	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA39372	(Get FASTA)	NCBI Sequence Viewer
	EDL02587	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000007318
	ENSMUSP00000007318.2
GenBank Protein	Q61765	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_034789 ⟸ NM_010659

- UniProtKB:

A2A5Y0 (UniProtKB/Swiss-Prot), Q61765 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MPYNCCLPALSCRTSCSSRPCVPPSCHGCTLPGACNIPANVGNCNWFCEGSFNGNEKETMQFLNDRLASYMEKVRQLERENAELECRIQERNQQQDPLVCPAYQAYFRTIEELQQKILCSKSENARLV
VQIDNAKLAADDFRTKYETELGLRQLVESDINGLRRILDELTLCKSDLEAQVESLKEELLCLKRNHEEEVNTLRCQLGDRLNVEVDAAPTVDLNRVLNETRCQYEAMVETNRREVEEWFTTQTEELNK
QVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHCMRNSLENTLTESEARYSSQLSQVQCLITNVESQLGEIRADLERQNQEYQVLLDVKARLECEINTYRGLLESEDCKLPCNPCATSNACGKPIGP
CVSNPCVPCPPPAPCTPCVPRPRCGPCNSFVR

hide sequence

Ensembl Acc Id:

ENSMUSP00000007318 ⟸ ENSMUST00000007318

Protein Domains

IF rod

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q61765-F1-model_v2	AlphaFold	Q61765	1-416	view protein structure

RGD ID:

8676650

Promoter ID:

EPDNEW_M16356

Type:

single initiation site

Name:

Krt31_1

Description:

Mus musculus keratin 31 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	100,050,551 - 100,050,611	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000048981	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000007318	ENTREZGENE
	ENSMUST00000007318.2	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot
	Single helix bin	UniProtKB/Swiss-Prot
	Vasodilator-stimulated phosphoprotein	UniProtKB/Swiss-Prot
InterPro	IF_conserved	UniProtKB/Swiss-Prot
	IF_rod_dom	UniProtKB/Swiss-Prot
	Keratin_I	UniProtKB/Swiss-Prot
KEGG Report	mmu:16660	UniProtKB/Swiss-Prot
MGD	MGI:1309993	ENTREZGENE
NCBI Gene	16660	ENTREZGENE
PANTHER	KERATIN, TYPE I CUTICULAR HA1-RELATED	UniProtKB/Swiss-Prot
	PTHR23239	UniProtKB/Swiss-Prot
Pfam	Filament	UniProtKB/Swiss-Prot
PhenoGen	Krt31	PhenoGen
PRINTS	TYPE1KERATIN	UniProtKB/Swiss-Prot
PROSITE	IF_ROD_1	UniProtKB/Swiss-Prot
	IF_ROD_2	UniProtKB/Swiss-Prot
SMART	Filament	UniProtKB/Swiss-Prot
Superfamily-SCOP	Intermediate filament protein, coiled coil region	UniProtKB/Swiss-Prot
	Prefoldin	UniProtKB/Swiss-Prot
UniProt	A2A5Y0	ENTREZGENE
	K1H1_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A2A5Y0	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Mammalian Phenotype