Symbol:
Tbc1d10a
Name:
TBC1 domain family, member 10a
RGD ID:
1615771
MGI Page
MGI
Description:
Predicted to enable GTPase activator activity and PDZ domain binding activity. Predicted to be involved in positive regulation of proteolysis and retrograde transport, endosome to Golgi. Predicted to be located in plasma membrane. Is expressed in renal calyx and vibrissa. Orthologous to human TBC1D10A (TBC1 domain family member 10A).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI447804; EBP50-PDX interactor of 64 kDa; EPI; EPI64; FLJ00288; mFLJ00288; RP23-453B22.5; TBC1 domain family member 10A; Tbc1d10
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TBC1D10A (TBC1 domain family member 10A) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tbc1d10a (TBC1 domain family, member 10a) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tbc1d10a (TBC1 domain family member 10A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TBC1D10A (TBC1 domain family member 10A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TBC1D10A (TBC1 domain family member 10A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tbc1d10a (TBC1 domain family member 10A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TBC1D10A (TBC1 domain family member 10A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TBC1D10A (TBC1 domain family member 10A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tbc1d10a (TBC1 domain family member 10A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tbc1d10a (TBC1 domain family, member 10a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TBC1D10A (TBC1 domain family member 10A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tbc1d10aa (TBC1 domain family, member 10Aa)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
tbc1d10ab (TBC1 domain family, member 10Ab)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
MSB3
Alliance
DIOPT (Ensembl Compara|InParanoid|PhylomeDB)
Caenorhabditis elegans (roundworm):
tbc-10
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
wkd
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tbc1d10a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 4,136,852 - 4,167,407 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 4,136,789 - 4,165,505 (+) Ensembl GRCm39 Ensembl GRCm38 11 4,186,833 - 4,215,507 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 4,186,789 - 4,215,505 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 4,086,836 - 4,115,508 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 4,086,836 - 4,115,508 (+) NCBI MGSCv36 mm8 Celera 11 4,683,776 - 4,712,449 (+) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 2.92 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tbc1d10a Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1605322 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TBC1D10A mRNA CTD PMID:22079256 Tbc1d10a Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of TBC1D10A mRNA CTD PMID:26682919 Tbc1d10a Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of TBC1D10A mRNA] CTD PMID:22206623 Tbc1d10a Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of TBC1D10A mRNA CTD PMID:22206623 Tbc1d10a Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TBC1D10A mRNA CTD PMID:17942748 Tbc1d10a Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TBC1D10A mRNA CTD PMID:39298647 Tbc1d10a Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1605322 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of TBC1D10A protein CTD PMID:31675489 Tbc1d10a Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TBC1D10A mRNA CTD PMID:17942748 Tbc1d10a Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1311641 6480464 Tetrachlorodibenzodioxin results in increased expression of TBC1D10A mRNA CTD PMID:33387578 Tbc1d10a Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TBC1D10A mRNA CTD PMID:21570461 Tbc1d10a Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1311641 6480464 Tetrachlorodibenzodioxin results in decreased expression of TBC1D10A mRNA CTD PMID:21215274 Tbc1d10a Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of TBC1D10A mRNA CTD PMID:20188158 Tbc1d10a Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of TBC1D10A mRNA CTD PMID:39298647 Tbc1d10a Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of TBC1D10A gene CTD PMID:31683443 Tbc1d10a Mouse acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of TBC1D10A mRNA CTD PMID:30807115 Tbc1d10a Mouse aflatoxin B1 decreases methylation ISO RGD:1605322 6480464 Aflatoxin B1 results in decreased methylation of TBC1D10A gene; Aflatoxin B1 results in decreased methylation more ... CTD PMID:27153756|PMID:30157460 Tbc1d10a Mouse aristolochic acid A increases expression ISO RGD:1605322 6480464 aristolochic acid I results in increased expression of TBC1D10A mRNA CTD PMID:33212167 Tbc1d10a Mouse arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of TBC1D10A mRNA CTD PMID:35676786 Tbc1d10a Mouse benzo[a]pyrene decreases methylation ISO RGD:1605322 6480464 Benzo(a)pyrene results in decreased methylation of TBC1D10A promoter CTD PMID:27901495 Tbc1d10a Mouse bis(2-ethylhexyl) phthalate increases expression ISO RGD:1605322 6480464 Diethylhexyl Phthalate results in increased expression of TBC1D10A mRNA CTD PMID:31163220 Tbc1d10a Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of TBC1D10A mRNA CTD PMID:34319233 Tbc1d10a Mouse bisphenol A increases expression ISO RGD:1311641 6480464 bisphenol A results in increased expression of TBC1D10A mRNA CTD PMID:30816183|PMID:32528016 Tbc1d10a Mouse bisphenol A decreases methylation ISO RGD:1605322 6480464 bisphenol A results in decreased methylation of TBC1D10A gene CTD PMID:31601247 Tbc1d10a Mouse bisphenol A decreases expression ISO RGD:1605322 6480464 bisphenol A results in decreased expression of TBC1D10A protein CTD PMID:31675489 Tbc1d10a Mouse bisphenol A decreases expression ISO RGD:1311641 6480464 bisphenol A results in decreased expression of TBC1D10A mRNA CTD PMID:33296240 Tbc1d10a Mouse butanal increases expression ISO RGD:1605322 6480464 butyraldehyde results in increased expression of TBC1D10A mRNA CTD PMID:26079696 Tbc1d10a Mouse cadmium dichloride decreases expression ISO RGD:1605322 6480464 Cadmium Chloride results in decreased expression of TBC1D10A mRNA CTD PMID:38568856 Tbc1d10a Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon results in decreased expression of TBC1D10A mRNA CTD PMID:25620056 Tbc1d10a Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of TBC1D10A mRNA CTD PMID:37019170 Tbc1d10a Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Tbc1d10a Mouse cisplatin multiple interactions ISO RGD:1605322 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of TBC1D10A mRNA CTD PMID:27392435 Tbc1d10a Mouse copper(II) sulfate increases expression ISO RGD:1605322 6480464 Copper Sulfate results in increased expression of TBC1D10A mRNA CTD PMID:19549813 Tbc1d10a Mouse cyclosporin A increases expression ISO RGD:1605322 6480464 Cyclosporine results in increased expression of TBC1D10A mRNA CTD PMID:25562108 Tbc1d10a Mouse DDE decreases expression ISO RGD:1605322 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of TBC1D10A mRNA CTD PMID:38568856 Tbc1d10a Mouse decabromodiphenyl ether decreases expression ISO RGD:1605322 6480464 decabromobiphenyl ether results in decreased expression of TBC1D10A protein CTD PMID:31675489 Tbc1d10a Mouse diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of TBC1D10A mRNA CTD PMID:35676786 Tbc1d10a Mouse doxorubicin decreases expression ISO RGD:1605322 6480464 Doxorubicin results in decreased expression of TBC1D10A mRNA CTD PMID:29803840 Tbc1d10a Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992|PMID:22206623 Tbc1d10a Mouse FR900359 affects phosphorylation ISO RGD:1605322 6480464 FR900359 affects the phosphorylation of TBC1D10A protein CTD PMID:37730182 Tbc1d10a Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Tbc1d10a Mouse lipopolysaccharide increases expression ISO RGD:1605322 6480464 Lipopolysaccharides results in increased expression of TBC1D10A mRNA CTD PMID:35811015 Tbc1d10a Mouse lipopolysaccharide multiple interactions ISO RGD:1605322 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TBC1D10A mRNA CTD PMID:35811015 Tbc1d10a Mouse niclosamide increases expression ISO RGD:1605322 6480464 Niclosamide results in increased expression of TBC1D10A mRNA CTD PMID:36318118 Tbc1d10a Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TBC1D10A more ... CTD PMID:35964746 Tbc1d10a Mouse p-chloromercuribenzoic acid decreases expression ISO RGD:1605322 6480464 p-Chloromercuribenzoic Acid results in decreased expression of TBC1D10A mRNA CTD PMID:27188386 Tbc1d10a Mouse paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TBC1D10A mRNA CTD PMID:17585979 Tbc1d10a Mouse paracetamol increases expression ISO RGD:1311641 6480464 Acetaminophen results in increased expression of TBC1D10A mRNA CTD PMID:33387578 Tbc1d10a Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of TBC1D10A mRNA CTD PMID:17562736 Tbc1d10a Mouse PCB138 decreases expression ISO RGD:1311641 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of TBC1D10A mRNA CTD PMID:23829299 Tbc1d10a Mouse perfluorohexanesulfonic acid decreases expression EXP 6480464 perfluorohexanesulfonic acid results in decreased expression of TBC1D10A mRNA CTD PMID:37995155 Tbc1d10a Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of TBC1D10A mRNA CTD PMID:19136022 Tbc1d10a Mouse pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of TBC1D10A mRNA CTD PMID:19136022 Tbc1d10a Mouse potassium chromate decreases expression ISO RGD:1605322 6480464 potassium chromate(VI) results in decreased expression of TBC1D10A mRNA CTD PMID:22079256 Tbc1d10a Mouse potassium chromate multiple interactions ISO RGD:1605322 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TBC1D10A mRNA CTD PMID:22079256 Tbc1d10a Mouse pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of TBC1D10A mRNA CTD PMID:28903501 Tbc1d10a Mouse resveratrol multiple interactions ISO RGD:1605322 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of TBC1D10A mRNA CTD PMID:23557933 Tbc1d10a Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1605322 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TBC1D10A mRNA CTD PMID:35811015 Tbc1d10a Mouse sodium arsenite increases expression ISO RGD:1605322 6480464 sodium arsenite results in increased expression of TBC1D10A mRNA CTD PMID:38568856 Tbc1d10a Mouse triphenyl phosphate affects expression ISO RGD:1605322 6480464 triphenyl phosphate affects the expression of TBC1D10A mRNA CTD PMID:37042841 Tbc1d10a Mouse urethane increases expression ISO RGD:1605322 6480464 Urethane results in increased expression of TBC1D10A mRNA CTD PMID:28818685 Tbc1d10a Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of TBC1D10A mRNA CTD PMID:17963808 Tbc1d10a Mouse valproic acid increases methylation ISO RGD:1605322 6480464 Valproic Acid results in increased methylation of TBC1D10A gene CTD PMID:29154799
(-)-epigallocatechin 3-gallate (ISO) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (EXP) acrylamide (EXP) aflatoxin B1 (ISO) aristolochic acid A (ISO) arsenous acid (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (ISO) butanal (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) chlorpyrifos (EXP) choline (EXP) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (EXP) doxorubicin (ISO) folic acid (EXP) FR900359 (ISO) L-methionine (EXP) lipopolysaccharide (ISO) niclosamide (ISO) nitrates (EXP) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) PCB138 (ISO) perfluorohexanesulfonic acid (EXP) phenobarbital (EXP) pirinixic acid (EXP) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (EXP,ISO)
Tbc1d10a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 4,136,852 - 4,167,407 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 4,136,789 - 4,165,505 (+) Ensembl GRCm39 Ensembl GRCm38 11 4,186,833 - 4,215,507 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 4,186,789 - 4,215,505 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 4,086,836 - 4,115,508 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 4,086,836 - 4,115,508 (+) NCBI MGSCv36 mm8 Celera 11 4,683,776 - 4,712,449 (+) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 2.92 NCBI
TBC1D10A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 30,291,990 - 30,326,941 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 30,291,990 - 30,326,947 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 30,687,979 - 30,722,930 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 29,017,979 - 29,052,894 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 22 14,487,683 - 14,522,588 (-) NCBI Celera Cytogenetic Map 22 q12.2 NCBI HuRef 22 13,649,780 - 13,684,744 (-) NCBI HuRef CHM1_1 22 30,647,114 - 30,682,078 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 30,755,329 - 30,790,284 (-) NCBI T2T-CHM13v2.0
Tbc1d10a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 83,278,151 - 83,307,178 (+) NCBI GRCr8 mRatBN7.2 14 79,051,822 - 79,083,603 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 79,055,432 - 79,083,600 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 83,496,159 - 83,523,867 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 84,736,238 - 84,763,946 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 81,182,137 - 81,209,845 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 84,417,320 - 84,445,034 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 84,417,320 - 84,445,034 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 85,098,646 - 85,127,054 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 84,810,214 - 84,837,928 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 84,829,295 - 84,857,428 (+) NCBI Celera 14 77,966,529 - 77,994,243 (+) NCBI Celera Cytogenetic Map 14 q21 NCBI
Tbc1d10a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 4,537,634 - 4,570,949 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 4,537,634 - 4,570,949 (-) NCBI ChiLan1.0 ChiLan1.0
TBC1D10A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 40,259,179 - 40,294,040 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 42,957,788 - 42,992,669 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 11,328,159 - 11,363,009 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 29,130,096 - 29,164,838 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 29,130,096 - 29,164,865 (-) Ensembl panpan1.1 panPan2
TBC1D10A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 23,446,251 - 23,478,287 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 23,446,607 - 23,478,317 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 23,317,434 - 23,349,461 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 23,830,218 - 23,862,484 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 23,830,243 - 23,862,523 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 23,531,901 - 23,563,925 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 23,794,735 - 23,826,752 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 23,855,089 - 23,887,117 (-) NCBI UU_Cfam_GSD_1.0
Tbc1d10a
TBC1D10A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 47,269,092 - 47,301,753 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 47,269,087 - 47,301,540 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 50,308,036 - 50,332,493 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TBC1D10A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 13,172,847 - 13,207,979 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 13,172,845 - 13,207,904 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 112,938,151 - 112,973,593 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tbc1d10a
.
Predicted Target Of
Count of predictions: 1055 Count of miRNA genes: 497 Interacting mature miRNAs: 595 Transcripts: ENSMUST00000041042, ENSMUST00000135089, ENSMUST00000147485, ENSMUST00000149465, ENSMUST00000151672, ENSMUST00000180088 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300599 Cocrb11_m cocaine related behavior 11 (mouse) Not determined 11 2670355 36671472 Mouse 26884446 Sklq10_m skull length QTL 10, 10 week (mouse) 11 3250000 62890826 Mouse 1300661 Lmr6_m leishmaniasis resistance 6 (mouse) Not determined 11 1 25976374 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 27095925 Pglq5_m pelvic girdle length QTL 5, 5 week (mouse) 11 3250000 19750000 Mouse 1357722 Vtbt11_m vertebral trabecular bone trait 11 (mouse) Not determined 11 1 23880487 Mouse 10044008 Hbnr15_m Heligmosomoides bakeri nematode resistance 15 (mouse) Not determined 11 227052 34227232 Mouse 27226798 Scvln18_m sacral vertebrae length 2, 16 week (mouse) 11 3250000 60690826 Mouse 27095919 Pglq10_m pelvic girdle length QTL 10, 10 week (mouse) 11 3250000 18450000 Mouse 1300768 Tshp9_m tooth shape 9 (mouse) Not determined 11 1 25976374 Mouse 1301765 Skull15_m skull morphology 15 (mouse) Not determined 11 1 25976374 Mouse 27095914 Pglq16_m pelvic girdle length QTL 16, 16 week (mouse) 11 3250000 18150000 Mouse 27095909 Scvln6_m sacral vertebrae length 2, 5 week (mouse) 11 3250000 44090827 Mouse 27095904 Scvln12_m sacral vertebrae length 2, 10 week (mouse) 11 3250000 34495048 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse
AI447804
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 4,215,176 - 4,215,407 UniSTS GRCm38 MGSCv37 11 4,115,179 - 4,115,410 UniSTS GRCm37 Celera 11 4,712,120 - 4,712,351 UniSTS Cytogenetic Map 11 A1 UniSTS Whitehead/MRC_RH 11 9.11 UniSTS
D19343
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 4,215,344 - 4,215,501 UniSTS GRCm38 MGSCv37 11 4,115,347 - 4,115,504 UniSTS GRCm37 Celera 11 4,712,288 - 4,712,445 UniSTS Cytogenetic Map 11 A1 UniSTS Whitehead_YAC 11 UniSTS
D11Dcr2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 4,194,818 - 4,194,911 UniSTS GRCm38 MGSCv37 11 4,094,821 - 4,094,914 UniSTS GRCm37 Celera 11 4,691,761 - 4,691,854 UniSTS Cytogenetic Map 11 A1 UniSTS cM Map 11 UniSTS
UniSTS:236509
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 4,215,235 - 4,215,459 UniSTS GRCm38 MGSCv37 11 4,115,238 - 4,115,462 UniSTS GRCm37 Celera 11 4,712,179 - 4,712,403 UniSTS Cytogenetic Map 11 A1 UniSTS
D11Bhm20
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 19 D1 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 12 D1 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 4 E1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 16 C1.1 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 2 E2 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 1 C1.3 UniSTS Cytogenetic Map 13 D2 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A2 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 16 C4 UniSTS Cytogenetic Map 3 G1 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 7 B1-B2 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map 11 B1.1 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map 10 D2 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 1 H6 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X C-D UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 11 A3.2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 19 B UniSTS cM Map 11 44.15 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000041042 ⟹ ENSMUSP00000036861
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,136,789 - 4,165,505 (+) Ensembl GRCm38.p6 Ensembl 11 4,186,789 - 4,215,505 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000135089
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,162,311 - 4,163,600 (+) Ensembl GRCm38.p6 Ensembl 11 4,212,311 - 4,213,600 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147485
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,136,789 - 4,164,885 (+) Ensembl GRCm38.p6 Ensembl 11 4,186,789 - 4,214,885 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000149465
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,162,475 - 4,163,856 (+) Ensembl GRCm38.p6 Ensembl 11 4,212,475 - 4,213,856 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000151672
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,155,423 - 4,159,990 (+) Ensembl GRCm38.p6 Ensembl 11 4,205,423 - 4,209,990 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000180088 ⟹ ENSMUSP00000136453
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,136,822 - 4,165,502 (+) Ensembl GRCm38.p6 Ensembl 11 4,186,822 - 4,215,502 (+) Ensembl
RefSeq Acc Id:
NM_134023 ⟹ NP_598784
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 4,136,852 - 4,167,407 (+) NCBI GRCm38 11 4,186,833 - 4,215,505 (+) NCBI MGSCv37 11 4,086,836 - 4,115,508 (+) RGD Celera 11 4,683,776 - 4,712,449 (+) RGD cM Map 11 ENTREZGENE
Sequence:
CCGGGCGGCTCAGGCGGCTGAGGTGGCCGCTGGCGCTCTGGTGGCGGGCGCGGCCGATATGGCGAAAAGCAGCAGAGAGAATGGGCCGCGCGAGCCCGCAGCAGGCGGGAGCCTGTCTGGGACCCGGG
hide sequence
RefSeq Acc Id:
NP_598784 ⟸ NM_134023
- UniProtKB:
P58802 (UniProtKB/Swiss-Prot), Q3US32 (UniProtKB/TrEMBL)
- Sequence:
MAKSSRENGPREPAAGGSLSGTRESLAQGPDAATADELSSLGSDSEANGFAERRIDKFGFIVGSQGAEGALEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLRCQKGIPPSLRGRAWQYLSGGK
hide sequence
Ensembl Acc Id:
ENSMUSP00000036861 ⟸ ENSMUST00000041042
Ensembl Acc Id:
ENSMUSP00000136453 ⟸ ENSMUST00000180088
RGD ID: 6822274 Promoter ID: MM_KWN:6220 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000041042, OTTMUST00000011266 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 4,086,491 - 4,086,991 (+) MPROMDB
RGD ID: 6822277 Promoter ID: MM_KWN:6221 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: OTTMUST00000011269 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 4,105,101 - 4,105,601 (+) MPROMDB
RGD ID: 6822273 Promoter ID: MM_KWN:6222 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Liver, Lung Transcripts: OTTMUST00000011267, OTTMUST00000011268 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 4,112,219 - 4,112,719 (+) MPROMDB
RGD ID: 8673782 Promoter ID: EPDNEW_M14922 Type: initiation region Name: Tbc1d10a_1 Description: Mus musculus TBC1 domain family, member 10a , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M14923 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 4,186,852 - 4,186,912 EPDNEW
RGD ID: 8673784 Promoter ID: EPDNEW_M14923 Type: multiple initiation site Name: Tbc1d10a_2 Description: Mus musculus TBC1 domain family, member 10a , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M14922 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 4,186,973 - 4,187,033 EPDNEW
