Symbol:
Ndc1
Name:
NDC1 transmembrane nucleoporin
RGD ID:
1614307
MGI Page
MGI
Description:
Predicted to enable protein-macromolecule adaptor activity. Predicted to be a structural constituent of nuclear pore. Acts upstream of or within homologous chromosome pairing at meiosis and spermatogenesis. Located in cytoplasm. Part of nuclear pore. Is expressed in several structures, including forelimb bud; gonad; lung; and spleen. Orthologous to human NDC1 (NDC1 transmembrane nucleoporin).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2810475A17Rik; AI450313; nucleoporin NDC1; RP23-392J14.4; s; skeletal fusions with sterility; sks; Tmem48; transmembrane protein 48
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NDC1 (NDC1 transmembrane nucleoporin) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Ndc1 (NDC1 transmembrane nucleoporin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ndc1 (NDC1 transmembrane nucleoporin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NDC1 (NDC1 transmembrane nucleoporin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NDC1 (NDC1 transmembrane nucleoporin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ndc1 (NDC1 transmembrane nucleoporin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NDC1 (NDC1 transmembrane nucleoporin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NDC1 (NDC1 transmembrane nucleoporin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ndc1 (NDC1 transmembrane nucleoporin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Ndc1 (NDC1 transmembrane nucleoporin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NDC1 (NDC1 transmembrane nucleoporin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ndc1 (NDC1 transmembrane nucleoporin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
NDC1
Alliance
DIOPT (Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
Ndc1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
npp-22
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ndc1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 107,225,244 - 107,273,543 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 107,224,981 - 107,273,543 (+) Ensembl GRCm39 Ensembl GRCm38 4 107,368,047 - 107,416,346 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 107,367,784 - 107,416,346 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 107,040,389 - 107,086,943 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 106,865,970 - 106,912,271 (+) NCBI MGSCv36 mm8 Celera 4 105,726,336 - 105,773,460 (+) NCBI Celera Cytogenetic Map 4 C7 NCBI cM Map 4 50.18 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ndc1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NDC1 mRNA CTD PMID:20702594 and PMID:21570461 Ndc1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ndc1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NDC1 mRNA CTD PMID:34747641 Ndc1 Mouse 2,3,7,8-Tetrachlorodibenzofuran affects expression EXP 6480464 2 more ... CTD PMID:20702594 Ndc1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of NDC1 mRNA CTD PMID:39298647 Ndc1 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO NDC1 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of NDC1 gene CTD PMID:31601247 Ndc1 Mouse 6-propyl-2-thiouracil increases expression ISO Ndc1 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of NDC1 mRNA CTD PMID:30047161 Ndc1 Mouse all-trans-retinoic acid decreases expression ISO NDC1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NDC1 mRNA CTD PMID:33167477 Ndc1 Mouse amitrole increases expression ISO Ndc1 (Rattus norvegicus) 6480464 Amitrole results in increased expression of NDC1 mRNA CTD PMID:30047161 Ndc1 Mouse antirheumatic drug decreases expression ISO NDC1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of NDC1 mRNA CTD PMID:24449571 Ndc1 Mouse aristolochic acid A decreases expression ISO NDC1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NDC1 mRNA CTD PMID:33212167 Ndc1 Mouse benzo[a]pyrene decreases expression ISO NDC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NDC1 mRNA CTD PMID:20064835 Ndc1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of NDC1 mRNA CTD PMID:22228805 Ndc1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of NDC1 mRNA CTD PMID:19770486 Ndc1 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO NDC1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Ndc1 Mouse bisphenol A decreases expression ISO Ndc1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of NDC1 mRNA CTD PMID:25181051 Ndc1 Mouse bisphenol A increases methylation ISO NDC1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of NDC1 gene CTD PMID:31601247 Ndc1 Mouse bisphenol A multiple interactions ISO NDC1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NDC1 gene CTD PMID:31601247 Ndc1 Mouse bisphenol A increases expression ISO Ndc1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of NDC1 mRNA CTD PMID:32145629 Ndc1 Mouse bisphenol A decreases expression ISO NDC1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NDC1 mRNA CTD PMID:29275510 Ndc1 Mouse Bisphenol A diglycidyl ether affects splicing EXP 6480464 bisphenol A diglycidyl ether affects the splicing of NDC1 mRNA CTD PMID:36464114 Ndc1 Mouse bisphenol AF affects splicing EXP 6480464 bisphenol AF affects the splicing of NDC1 mRNA CTD PMID:36464114 Ndc1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of NDC1 mRNA CTD PMID:38685157 Ndc1 Mouse cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of NDC1 mRNA CTD PMID:20883709 Ndc1 Mouse cadmium dichloride decreases expression ISO NDC1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NDC1 mRNA CTD PMID:38568856 Ndc1 Mouse caffeine affects phosphorylation ISO NDC1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of NDC1 protein CTD PMID:35688186 Ndc1 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Ndc1 Mouse CGP 52608 multiple interactions ISO NDC1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NDC1 gene] CTD PMID:28238834 Ndc1 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of NDC1 mRNA CTD PMID:37019170 Ndc1 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NDC1 gene CTD PMID:20938992 Ndc1 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of NDC1 mRNA CTD PMID:27462272 Ndc1 Mouse copper atom multiple interactions ISO NDC1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of NDC1 mRNA CTD PMID:20971185 Ndc1 Mouse copper atom increases expression EXP 6480464 Copper results in increased expression of NDC1 mRNA CTD PMID:17205981 Ndc1 Mouse copper(0) multiple interactions ISO NDC1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of NDC1 mRNA CTD PMID:20971185 Ndc1 Mouse copper(0) increases expression EXP 6480464 Copper results in increased expression of NDC1 mRNA CTD PMID:17205981 Ndc1 Mouse coumarin decreases phosphorylation ISO NDC1 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of NDC1 protein CTD PMID:35688186 Ndc1 Mouse coumestrol multiple interactions ISO NDC1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Ndc1 Mouse coumestrol increases expression ISO NDC1 (Homo sapiens) 6480464 Coumestrol results in increased expression of NDC1 mRNA CTD PMID:19167446 Ndc1 Mouse cyclosporin A decreases expression ISO NDC1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NDC1 mRNA CTD PMID:20106945 Ndc1 Mouse cyclosporin A increases expression ISO NDC1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of NDC1 mRNA CTD PMID:25562108 Ndc1 Mouse DDE increases expression ISO NDC1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of NDC1 mRNA CTD PMID:38568856 Ndc1 Mouse Dibutyl phosphate affects expression ISO NDC1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NDC1 mRNA CTD PMID:37042841 Ndc1 Mouse dioxygen decreases expression ISO NDC1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of NDC1 mRNA CTD PMID:26516004 Ndc1 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of NDC1 mRNA CTD PMID:30529165 Ndc1 Mouse dorsomorphin multiple interactions ISO NDC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NDC1 mRNA CTD PMID:27188386 Ndc1 Mouse doxorubicin decreases expression ISO NDC1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NDC1 mRNA CTD PMID:29803840 Ndc1 Mouse Enterolactone multiple interactions ISO NDC1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of NDC1 mRNA CTD PMID:19167446 Ndc1 Mouse ethyl methanesulfonate decreases expression ISO NDC1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of NDC1 mRNA CTD PMID:23649840 Ndc1 Mouse flutamide decreases expression ISO Ndc1 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of NDC1 mRNA CTD PMID:24793618 Ndc1 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NDC1 gene CTD PMID:20938992 Ndc1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of NDC1 mRNA CTD PMID:25629700 Ndc1 Mouse formaldehyde decreases expression ISO NDC1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of NDC1 mRNA CTD PMID:23649840 Ndc1 Mouse FR900359 affects phosphorylation ISO NDC1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of NDC1 protein CTD PMID:37730182 Ndc1 Mouse fulvestrant multiple interactions ISO NDC1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NDC1 gene and [bisphenol S co-treated with Fulvestrant] results in decreased methylation of NDC1 gene CTD PMID:31601247 Ndc1 Mouse furan increases expression ISO Ndc1 (Rattus norvegicus) 6480464 furan results in increased expression of NDC1 mRNA CTD PMID:25539665 Ndc1 Mouse gentamycin decreases expression ISO Ndc1 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of NDC1 mRNA CTD PMID:33387578 Ndc1 Mouse ivermectin decreases expression ISO NDC1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NDC1 protein CTD PMID:32959892 Ndc1 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NDC1 gene CTD PMID:20938992 Ndc1 Mouse menadione affects expression ISO NDC1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of NDC1 mRNA CTD PMID:20044591 Ndc1 Mouse methimazole increases expression ISO Ndc1 (Rattus norvegicus) 6480464 Methimazole results in increased expression of NDC1 mRNA CTD PMID:30047161 Ndc1 Mouse methyl methanesulfonate decreases expression ISO NDC1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NDC1 mRNA CTD PMID:23649840 Ndc1 Mouse nickel atom increases expression ISO NDC1 (Homo sapiens) 6480464 Nickel results in increased expression of NDC1 mRNA CTD PMID:25583101 Ndc1 Mouse ozone decreases expression EXP 6480464 Ozone results in decreased expression of NDC1 mRNA CTD PMID:24336422 Ndc1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of NDC1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of NDC1 mRNA CTD PMID:34911549 Ndc1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of NDC1 mRNA CTD PMID:17562736 Ndc1 Mouse paracetamol increases expression ISO Ndc1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of NDC1 mRNA CTD PMID:33387578 Ndc1 Mouse paracetamol decreases expression ISO NDC1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NDC1 mRNA CTD PMID:21420995 and PMID:29067470 Ndc1 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of NDC1 mRNA CTD PMID:23811191 Ndc1 Mouse resveratrol multiple interactions ISO NDC1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of NDC1 mRNA CTD PMID:19167446 Ndc1 Mouse resveratrol increases expression EXP 6480464 resveratrol results in increased expression of NDC1 protein CTD PMID:25505154 Ndc1 Mouse rimonabant affects expression EXP 6480464 Rimonabant affects the expression of NDC1 mRNA CTD PMID:19030233 Ndc1 Mouse rotenone increases expression ISO Ndc1 (Rattus norvegicus) 6480464 Rotenone results in increased expression of NDC1 mRNA CTD PMID:28374803 Ndc1 Mouse SB 431542 multiple interactions ISO NDC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NDC1 mRNA CTD PMID:27188386 Ndc1 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of NDC1 mRNA CTD PMID:20883709 Ndc1 Mouse sodium arsenite decreases expression ISO NDC1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NDC1 mRNA CTD PMID:38568856 Ndc1 Mouse sodium dichromate increases expression ISO Ndc1 (Rattus norvegicus) 6480464 sodium bichromate results in increased expression of NDC1 mRNA CTD PMID:25993096 Ndc1 Mouse sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of NDC1 mRNA and Sodium Fluoride results in decreased expression of NDC1 protein CTD PMID:27862939 and PMID:28918527 Ndc1 Mouse succimer multiple interactions EXP 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of NDC1 mRNA CTD PMID:21641980 Ndc1 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of NDC1 mRNA CTD PMID:31919559 Ndc1 Mouse thioacetamide increases expression ISO Ndc1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of NDC1 mRNA CTD PMID:23411599 and PMID:34492290 Ndc1 Mouse thiram decreases expression ISO NDC1 (Homo sapiens) 6480464 Thiram results in decreased expression of NDC1 mRNA CTD PMID:38568856 Ndc1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of NDC1 gene CTD PMID:35295148 Ndc1 Mouse trichostatin A affects expression ISO NDC1 (Homo sapiens) 6480464 trichostatin A affects the expression of NDC1 mRNA CTD PMID:28542535 Ndc1 Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of NDC1 mRNA CTD PMID:19042947 Ndc1 Mouse triphenyl phosphate affects expression ISO NDC1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NDC1 mRNA CTD PMID:37042841 Ndc1 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of NDC1 mRNA CTD PMID:33045310 Ndc1 Mouse troglitazone increases expression EXP 6480464 troglitazone results in increased expression of NDC1 mRNA CTD PMID:28973697 Ndc1 Mouse valproic acid increases expression ISO NDC1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NDC1 mRNA CTD PMID:23179753 more ... Ndc1 Mouse valproic acid multiple interactions ISO NDC1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NDC1 mRNA CTD PMID:27188386 Ndc1 Mouse vinclozolin increases methylation ISO Ndc1 (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of NDC1 gene CTD PMID:31682807
2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (ISO) all-trans-retinoic acid (ISO) amitrole (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (ISO) Bisphenol A diglycidyl ether (EXP) bisphenol AF (EXP) bisphenol F (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) choline (EXP) clobetasol (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) coumarin (ISO) coumestrol (ISO) cyclosporin A (ISO) DDE (ISO) Dibutyl phosphate (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) Enterolactone (ISO) ethyl methanesulfonate (ISO) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) furan (ISO) gentamycin (ISO) ivermectin (ISO) L-methionine (EXP) menadione (ISO) methimazole (ISO) methyl methanesulfonate (ISO) nickel atom (ISO) ozone (EXP) paracetamol (EXP,ISO) pirinixic acid (EXP) resveratrol (EXP,ISO) rimonabant (EXP) rotenone (ISO) SB 431542 (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sodium fluoride (EXP) succimer (EXP) tetrachloromethane (EXP) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) trichostatin A (ISO) trimellitic anhydride (EXP) triphenyl phosphate (ISO) triptonide (EXP) troglitazone (EXP) valproic acid (ISO) vinclozolin (ISO)
Ndc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 107,225,244 - 107,273,543 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 107,224,981 - 107,273,543 (+) Ensembl GRCm39 Ensembl GRCm38 4 107,368,047 - 107,416,346 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 107,367,784 - 107,416,346 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 107,040,389 - 107,086,943 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 106,865,970 - 106,912,271 (+) NCBI MGSCv36 mm8 Celera 4 105,726,336 - 105,773,460 (+) NCBI Celera Cytogenetic Map 4 C7 NCBI cM Map 4 50.18 NCBI
NDC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 53,765,478 - 53,838,296 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 53,765,478 - 53,838,463 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 54,231,151 - 54,303,969 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 54,005,976 - 54,076,763 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 52,518,833 - 52,591,931 (-) NCBI Celera Cytogenetic Map 1 p32.3 NCBI HuRef 1 52,345,908 - 52,420,041 (-) NCBI HuRef CHM1_1 1 54,347,580 - 54,420,672 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 53,648,324 - 53,721,147 (-) NCBI T2T-CHM13v2.0
Ndc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 127,384,172 - 127,431,093 (+) NCBI GRCr8 mRatBN7.2 5 122,155,992 - 122,202,295 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 122,155,967 - 122,202,291 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 124,775,477 - 124,819,897 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 126,498,512 - 126,542,930 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 126,549,827 - 126,594,247 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 126,976,636 - 127,022,941 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 126,976,456 - 127,022,939 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 130,824,420 - 130,870,782 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 128,469,764 - 128,510,890 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 120,901,680 - 120,945,858 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
Ndc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 5,424,710 - 5,476,657 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 5,424,710 - 5,476,657 (+) NCBI ChiLan1.0 ChiLan1.0
NDC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 172,996,504 - 173,069,420 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 172,137,290 - 172,210,257 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 53,041,298 - 53,113,181 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 54,637,637 - 54,708,084 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 54,637,637 - 54,708,078 (-) Ensembl panpan1.1 panPan2
NDC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 55,161,079 - 55,207,969 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 55,160,743 - 55,455,423 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 55,227,519 - 55,274,615 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 55,349,204 - 55,396,311 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 55,349,455 - 55,396,289 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 55,343,295 - 55,390,284 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 55,233,538 - 55,280,629 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 55,622,932 - 55,669,936 (+) NCBI UU_Cfam_GSD_1.0
Ndc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 68,060,620 - 68,112,880 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 7,302,776 - 7,355,794 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 7,303,366 - 7,353,700 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NDC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 158,458,840 - 158,514,785 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 158,458,597 - 158,515,057 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 146,159,735 - 146,214,106 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NDC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 79,097,579 - 79,165,732 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 79,098,843 - 79,165,814 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 38,118,705 - 38,186,249 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ndc1
.
Predicted Target Of
Count of predictions: 2894 Count of miRNA genes: 768 Interacting mature miRNAs: 1017 Transcripts: ENSMUST00000030357, ENSMUST00000125342, ENSMUST00000132950, ENSMUST00000139560, ENSMUST00000149366, ENSMUST00000150800 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226782 Tibl2_m tibia length 2, 5 week (mouse) 4 90888237 111257197 Mouse 13824982 Svwq1_m seminal vesicle weight QTL 1 (mouse) 4 89888237 118857197 Mouse 11532714 Sluc43_m susceptibility to lung cancer 43 (mouse) 4 46642108 123127211 Mouse 12904002 Opfaq9_m open field activity QTL 9 (mouse) 4 92975790 126975790 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 1357726 Lnopy1_m lens opacity 1 (mouse) Not determined 4 85428838 119429037 Mouse 11532708 Sluc43i_m susceptibility to lung cancer 43i (mouse) 4 74444699 108444983 Mouse 11532707 Sluc43h_m susceptibility to lung cancer 43h (mouse) 4 74444699 108444983 Mouse 11532706 Sluc43c_m susceptibility to lung cancer 43c (mouse) 4 74444699 108444983 Mouse 27226770 Tibl11_m tibia length 11, 10 week (mouse) 4 88518237 108357197 Mouse 11532705 Sluc43b_m susceptibility to lung cancer 43b (mouse) 4 74444699 108444983 Mouse 11532704 Sluc43a_m susceptibility to lung cancer 43a (mouse) 4 74444699 108444983 Mouse 14696687 Gdq1_m grooming duration QTL 1, males (mouse) 4 96888237 111857197 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 27226766 Tibl17_m tibia length 17, 16 week (mouse) 4 88518237 108457197 Mouse 14696689 Gdq2_m grooming duration QTL 2, females (mouse) 4 100857197 124893793 Mouse 27226760 Feml19_m femur length 19, 16 week (mouse) 4 90888237 108457197 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 1302031 Bulb1_m bulb size 1 (mouse) Not determined 4 74033887 108034029 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 27095939 Ulnl9_m ulna length 9, 16 week (mouse) 4 65318237 118857197 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 12904933 Edlmmq3_m extensor digitorum longus muscle mass QTL 3 (mouse) 4 81213991 115213991 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300918 Stheal4_m soft tissue heal 4 (mouse) Not determined 4 89969627 123969747 Mouse 1301556 Cd4vts1_m CD4 virgin T cell subset 1 (mouse) Not determined 4 85428838 119429037 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 1302204 Spm1_m splenomegaly modifier (mouse) Not determined 4 82244395 116244582 Mouse 11532703 Sluc43g_m susceptibility to lung cancer 43g (mouse) 4 74444699 108444983 Mouse 11532702 Sluc43f_m susceptibility to lung cancer 43f (mouse) 4 74444699 108444983 Mouse 11532701 Sluc43e_m susceptibility to lung cancer 43e (mouse) 4 74444699 108444983 Mouse 11532700 Sluc43d_m susceptibility to lung cancer 43d (mouse) 4 74444699 108444983 Mouse 11039517 Ltpr4_m Leishmania tropica response 4 (mouse) 4 79365751 113365867 Mouse 11039504 Ltpr4a_m Leishmania tropica response 4a (mouse) 4 79365751 113365867 Mouse 11039505 Ltpr4c_m Leishmania tropica response 4c (mouse) 4 79365751 113365867 Mouse 1301930 Papg1_m pulmonary adenoma progression 1 (mouse) Not determined 4 85781167 119781279 Mouse 1301545 Gauc_m glucose area under curve (mouse) Not determined 4 76763107 110763305 Mouse 11039506 Ltpr4b_m Leishmania tropica response 4b (mouse) 4 79365751 113365867 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 10412193 Plep_m plasma lepin levels (mouse) Not determined 4 74444699 108444983 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 1300689 Dob1_m Dietary obesity 1 (mouse) Body weight 4 101574601 123127211 Mouse 27226716 Metcl2_m metatarsal-calcaneal length 2, 5 week (mouse) 4 88118237 118557197 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 1300697 Sle2_m systemic lupus erythmatosus susceptibility 2 (mouse) Not determined 4 77957579 111957775 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 26884431 Zlq8_m zygomatic length QTL 8, 16 week (mouse) 4 74718237 108357197 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 4142047 Mvwf3_m modifier of von Willebrand factor 3 (mouse) Not determined 14010457 117072206 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 27095927 Pglq7_m pelvic girdle length QTL 7, 10 week (mouse) 4 88118237 108357197 Mouse 27095921 Pglq12_m pelvic girdle length QTL 12, 16 week (mouse) 4 83118237 108357197 Mouse 27226739 Metcl14_m metatarsal-calcaneal length 14, 16 week (mouse) 4 87518237 108357197 Mouse 1301118 Bbaa23_m B.burgdorferi-associated arthritis 23 (mouse) Not determined 4 85781167 119781279 Mouse 11532738 Abd1_m autoimmune biliary disease 1 (mouse) 4 88982069 116271120 Mouse 15039368 Nmrs19_m NAFLD-associated magnetic resonance shift 19 (mouse) 4 90882780 124882780 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 4141900 Skts-fp1_m skin tumor susceptibility in FVB and PWK 1 (mouse) Not determined 4 53550839 124055180 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 1300580 Lbw2_m lupus NZB x NZW 2 (mouse) Not determined 4 98545539 128009280 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 1301867 Idd11_m insulin dependent diabetes susceptibility 11 (mouse) Not determined 4 83604870 117605006 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27226724 Tibw2_m tibia width 2, proximal, 10 week (mouse) 4 43000000 108357197 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 11553870 Cmmm_m carcinoma modifier of MSM (mouse) 4 90590668 124590781 Mouse
BB401137
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 107,414,430 - 107,414,575 UniSTS GRCm38 MGSCv37 4 107,087,035 - 107,087,180 UniSTS GRCm37 Celera 4 105,773,552 - 105,773,697 UniSTS Cytogenetic Map 4 C7 UniSTS Whitehead/MRC_RH 4 1484.72 UniSTS
UniSTS:234989
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 107,410,456 - 107,410,695 UniSTS GRCm38 MGSCv37 4 107,083,061 - 107,083,300 UniSTS GRCm37 Celera 4 105,769,578 - 105,769,817 UniSTS Cytogenetic Map 4 C7 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000030357 ⟹ ENSMUSP00000136239
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 107,225,077 - 107,271,530 (+) Ensembl GRCm38.p6 Ensembl 4 107,367,880 - 107,414,333 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000125342 ⟹ ENSMUSP00000136850
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 107,225,249 - 107,268,347 (+) Ensembl GRCm38.p6 Ensembl 4 107,368,052 - 107,411,150 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000132950
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 107,238,659 - 107,247,489 (+) Ensembl GRCm38.p6 Ensembl 4 107,381,462 - 107,390,292 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000139560 ⟹ ENSMUSP00000120365
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 107,224,981 - 107,273,543 (+) Ensembl GRCm38.p6 Ensembl 4 107,367,784 - 107,416,346 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000149366 ⟹ ENSMUSP00000137180
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 107,225,112 - 107,273,520 (+) Ensembl GRCm38.p6 Ensembl 4 107,367,915 - 107,416,323 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000150800
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 107,238,282 - 107,243,807 (+) Ensembl GRCm38.p6 Ensembl 4 107,381,085 - 107,386,610 (+) Ensembl
RefSeq Acc Id:
NM_028355 ⟹ NP_082631
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 107,225,244 - 107,273,543 (+) NCBI GRCm38 4 107,368,047 - 107,416,346 (+) NCBI MGSCv37 4 107,040,389 - 107,086,943 (+) RGD Celera 4 105,726,336 - 105,773,460 (+) RGD cM Map 4 ENTREZGENE
Sequence:
ACTCTGTCCCCGGCACGCTTGAGAGCGGGGGCCGCCATCTCCATGGCCACGGCTGCGAGCGGGCCCTGCGCCGGCGGGTCGCCGCGGGACATCCTTTGGCGCGTTTTGGGTTGGAGGATAGTTACCAG
hide sequence
RefSeq Acc Id:
NR_165083
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 107,225,244 - 107,273,543 (+) NCBI GRCm38 4 107,368,047 - 107,416,346 (+) NCBI
Sequence:
ACTCTGTCCCCGGCACGCTTGAGAGCGGGGGCCGCCATCTCCATGGCCACGGCTGCGAGCGGGCCCTGCGCCGGCGGGTCGCCGCGGGACATCCTTTGGCGCGTGAGTTAGCGAGCCGTGGCGCTCCC
hide sequence
RefSeq Acc Id:
NP_082631 ⟸ NM_028355
- UniProtKB:
Q8VCB1 (UniProtKB/Swiss-Prot)
- Sequence:
MATAASGPCAGGSPRDILWRVLGWRIVTSIVWSVVLLPVCITAFIVLSSINLFHPIQWLSDSCNDFYSSQVIFHLLLLAVVIIIISIFNVEFYTVVPSISGSRLALIARILHPQQLTHSFIHAAMGMA
hide sequence
Ensembl Acc Id:
ENSMUSP00000136850 ⟸ ENSMUST00000125342
Ensembl Acc Id:
ENSMUSP00000120365 ⟸ ENSMUST00000139560
Ensembl Acc Id:
ENSMUSP00000137180 ⟸ ENSMUST00000149366
Ensembl Acc Id:
ENSMUSP00000136239 ⟸ ENSMUST00000030357
RGD ID: 6836533 Promoter ID: MM_KWN:38841 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung Transcripts: OTTMUST00000020102, OTTMUST00000020157, OTTMUST00000020158, OTTMUST00000020161 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 107,040,326 - 107,040,826 (+) MPROMDB
RGD ID: 6884086 Promoter ID: EPDNEW_M5494 Type: initiation region Name: Ndc1_2 Description: Mus musculus NDC1 transmembrane nucleoporin , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5495 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 107,367,800 - 107,367,860 EPDNEW
RGD ID: 6884090 Promoter ID: EPDNEW_M5495 Type: initiation region Name: Ndc1_1 Description: Mus musculus NDC1 transmembrane nucleoporin , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5494 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 107,368,047 - 107,368,107 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-07-02
Ndc1
NDC1 transmembrane nucleoporin
Tmem48
transmembrane protein 48
Symbol and/or name change
5135510 APPROVED
