Symbol:
KRT80
Name:
keratin 80
RGD ID:
1606454
HGNC Page
HGNC:27056
Description:
Predicted to be a structural constituent of skin epidermis. Predicted to be involved in intermediate filament organization and keratinization. Located in cytoplasm and intermediate filament.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
CK-80; cytokeratin-80; K80; KB20; keratin 80, type II; keratin b20; keratin, type II cytoskeletal 80; keratin-80; type II keratin; type-II keratin Kb20
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Krt80 (keratin 80) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Krt80 (keratin 80) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Krt80 (keratin 80) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
KRT80 (keratin 80) NCBI
Ortholog
Canis lupus familiaris (dog):
KRT80 (keratin 80) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Krt80 (keratin 80) NCBI
Ortholog
Sus scrofa (pig):
KRT80 (keratin 80) HGNC
Ensembl, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
KRT80 (keratin 80) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Krt80 (keratin 80) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Krt80 (keratin 80)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Krt80 (keratin 80)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-183i3.5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Danio rerio (zebrafish):
zgc:136930
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus laevis (African clawed frog):
krt80.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
krt80.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 52,168,996 - 52,192,014 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 52,168,996 - 52,192,014 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 52,562,780 - 52,585,798 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 50,849,047 - 50,872,051 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 51,365,224 - 51,388,227 (-) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 49,596,065 - 49,619,064 (-) NCBI HuRef CHM1_1 12 52,529,044 - 52,552,043 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 52,132,581 - 52,155,594 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
KRT80 Human (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of KRT80 mRNA CTD PMID:23825647 KRT80 Human 1-naphthyl isothiocyanate increases expression ISO RGD:1359177 6480464 1-Naphthylisothiocyanate results in increased expression of KRT80 mRNA CTD PMID:30723492 KRT80 Human 17beta-estradiol decreases expression ISO RGD:1623931 6480464 Estradiol results in decreased expression of KRT80 mRNA CTD PMID:19484750 KRT80 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of KRT80 mRNA CTD PMID:31614463 KRT80 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of KRT80 mRNA CTD PMID:30165855 KRT80 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1623931 6480464 Tetrachlorodibenzodioxin results in increased expression of KRT80 mRNA CTD PMID:19933214 KRT80 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1359177 6480464 Tetrachlorodibenzodioxin results in increased expression of KRT80 mRNA CTD PMID:33387578 KRT80 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KRT80 mRNA CTD PMID:23152189 KRT80 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1623931 6480464 Tetrachlorodibenzodioxin affects the expression of KRT80 mRNA CTD PMID:21570461 KRT80 Human 2,3,7,8-Tetrachlorodibenzofuran increases expression ISO RGD:1359177 6480464 2,3,7,8-tetrachlorodibenzofuran results in increased expression of KRT80 mRNA CTD PMID:32109520 KRT80 Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1623931 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of KRT80 mRNA CTD PMID:38648751 KRT80 Human 2,6-dimethoxyphenol multiple interactions EXP 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization more ... CTD PMID:38598786 KRT80 Human 2-hydroxypropanoic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of KRT80 mRNA CTD PMID:30851411 KRT80 Human 4,4'-sulfonyldiphenol increases expression ISO RGD:1623931 6480464 bisphenol S results in increased expression of KRT80 mRNA CTD PMID:30951980 KRT80 Human 4-hydroxyphenyl retinamide decreases expression ISO RGD:1623931 6480464 Fenretinide results in decreased expression of KRT80 mRNA CTD PMID:28973697 KRT80 Human 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of KRT80 mRNA CTD PMID:21527772 KRT80 Human actinomycin D increases expression EXP 6480464 Dactinomycin results in increased expression of KRT80 mRNA CTD PMID:21527772 KRT80 Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of KRT80 mRNA; Aflatoxin B1 results in increased expression more ... CTD PMID:21527772|PMID:22100608 KRT80 Human Archazolid B decreases expression EXP 6480464 archazolid B results in decreased expression of KRT80 mRNA CTD PMID:25218289 KRT80 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of KRT80 mRNA; aristolochic acid I results in more ... CTD PMID:33212167 KRT80 Human arsane multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:32525701|PMID:39836092 KRT80 Human arsenic atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:32525701|PMID:39836092 KRT80 Human benzo[a]pyrene increases expression ISO RGD:1623931 6480464 Benzo(a)pyrene results in increased expression of KRT80 mRNA CTD PMID:22610609 KRT80 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of KRT80 mRNA CTD PMID:32234424 KRT80 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of KRT80 mRNA CTD PMID:19150397 KRT80 Human benzo[b]fluoranthene increases expression ISO RGD:1623931 6480464 benzo(b)fluoranthene results in increased expression of KRT80 mRNA CTD PMID:26377693 KRT80 Human bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of KRT80 mRNA CTD PMID:25102026 KRT80 Human bisphenol A decreases expression ISO RGD:1359177 6480464 bisphenol A results in decreased expression of KRT80 mRNA CTD PMID:25181051 KRT80 Human bisphenol A increases expression ISO RGD:1623931 6480464 bisphenol A results in increased expression of KRT80 mRNA CTD PMID:32156529 KRT80 Human bisphenol A decreases methylation ISO RGD:1623931 6480464 bisphenol A results in decreased methylation of KRT80 promoter CTD PMID:27312807 KRT80 Human bisphenol F increases expression ISO RGD:1623931 6480464 bisphenol F results in increased expression of KRT80 mRNA CTD PMID:30951980 KRT80 Human butanal increases expression EXP 6480464 butyraldehyde results in increased expression of KRT80 mRNA CTD PMID:26079696 KRT80 Human cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of KRT80 mRNA CTD PMID:24376830 KRT80 Human calcitriol multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of KRT80 mRNA CTD PMID:21592394 KRT80 Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of KRT80 mRNA CTD PMID:21592394 KRT80 Human carbon nanotube increases expression ISO RGD:1623931 6480464 Nanotubes, Carbon analog results in increased expression of KRT80 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 KRT80 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KRT80 mRNA CTD PMID:27392435 KRT80 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of KRT80 mRNA CTD PMID:27392435 KRT80 Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of KRT80 mRNA CTD PMID:20971185 KRT80 Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of KRT80 mRNA CTD PMID:20971185 KRT80 Human coumestrol decreases expression EXP 6480464 Coumestrol results in decreased expression of KRT80 mRNA CTD PMID:19167446 KRT80 Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of KRT80 mRNA CTD PMID:19167446 KRT80 Human cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of KRT80 mRNA CTD PMID:21527772 KRT80 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of KRT80 mRNA CTD PMID:25562108 KRT80 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of KRT80 mRNA CTD PMID:27989131 KRT80 Human endosulfan affects expression ISO RGD:1359177 6480464 Endosulfan affects the expression of KRT80 mRNA CTD PMID:29391264 KRT80 Human Enterolactone multiple interactions EXP 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of KRT80 mRNA CTD PMID:19167446 KRT80 Human epoxiconazole decreases expression ISO RGD:1623931 6480464 epoxiconazole results in decreased expression of KRT80 mRNA CTD PMID:35436446 KRT80 Human ethanol multiple interactions EXP 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ... CTD PMID:29432896 KRT80 Human ethylparaben increases expression EXP 6480464 ethyl-p-hydroxybenzoate results in increased expression of KRT80 mRNA CTD PMID:37690743 KRT80 Human etoposide increases expression EXP 6480464 Etoposide results in increased expression of KRT80 mRNA CTD PMID:21527772 KRT80 Human furfural multiple interactions EXP 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization more ... CTD PMID:38598786 KRT80 Human gentamycin increases expression ISO RGD:1359177 6480464 Gentamicins results in increased expression of KRT80 mRNA CTD PMID:33387578 KRT80 Human hexadecanoic acid decreases phosphorylation EXP 6480464 Palmitic Acid results in decreased phosphorylation of KRT80 protein CTD PMID:28073184 KRT80 Human hydroquinone increases expression EXP 6480464 hydroquinone results in increased expression of KRT80 mRNA CTD PMID:31256213 KRT80 Human lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of KRT80 mRNA CTD PMID:38568856 KRT80 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of KRT80 mRNA CTD PMID:35811015 KRT80 Human manganese atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 KRT80 Human manganese(0) multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 KRT80 Human manganese(II) chloride multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 KRT80 Human metformin increases expression EXP 6480464 Metformin results in increased expression of KRT80 mRNA CTD PMID:21527772 KRT80 Human methamphetamine increases expression ISO RGD:1359177 6480464 Methamphetamine results in increased expression of KRT80 mRNA CTD PMID:28341135 KRT80 Human methoxychlor affects methylation ISO RGD:1359177 6480464 Methoxychlor affects the methylation of KRT80 gene CTD PMID:35440735 KRT80 Human methyl methanesulfonate increases expression EXP 6480464 Methyl Methanesulfonate results in increased expression of KRT80 mRNA CTD PMID:21527772 KRT80 Human N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of KRT80 mRNA CTD PMID:21527772 KRT80 Human nicotine increases expression EXP 6480464 Nicotine results in increased expression of KRT80 mRNA CTD PMID:23825647 KRT80 Human okadaic acid increases expression EXP 6480464 Okadaic Acid results in increased expression of KRT80 mRNA CTD PMID:38832940 KRT80 Human ozone decreases expression ISO RGD:1623931 6480464 Ozone results in decreased expression of KRT80 mRNA CTD PMID:33026818 KRT80 Human paracetamol decreases expression ISO RGD:1359177 6480464 Acetaminophen results in decreased expression of KRT80 mRNA CTD PMID:33387578 KRT80 Human paraquat increases expression ISO RGD:1359177 6480464 Paraquat results in increased expression of KRT80 mRNA CTD PMID:32680482 KRT80 Human pentanal increases expression EXP 6480464 pentanal results in increased expression of KRT80 mRNA CTD PMID:26079696 KRT80 Human perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of KRT80 mRNA CTD PMID:27153767 KRT80 Human propanal increases expression EXP 6480464 propionaldehyde results in increased expression of KRT80 mRNA CTD PMID:26079696 KRT80 Human rac-lactic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of KRT80 mRNA CTD PMID:30851411 KRT80 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of KRT80 mRNA CTD PMID:35811015 KRT80 Human S-(1,2-dichlorovinyl)-L-cysteine decreases expression EXP 6480464 S-(1,2-dichlorovinyl)cysteine results in decreased expression of KRT80 mRNA CTD PMID:35811015 KRT80 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of KRT80 mRNA CTD PMID:25895662 KRT80 Human sodium arsenate multiple interactions EXP 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KRT80 more ... CTD PMID:32525701 KRT80 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of KRT80 mRNA CTD PMID:38568856 KRT80 Human sodium arsenite multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 KRT80 Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of KRT80 protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 KRT80 Human sodium dodecyl sulfate decreases expression EXP 6480464 Sodium Dodecyl Sulfate results in decreased expression of KRT80 mRNA CTD PMID:31734321 KRT80 Human sodium fluoride increases expression ISO RGD:1623931 6480464 Sodium Fluoride results in increased expression of KRT80 mRNA CTD PMID:27862939 KRT80 Human sulforaphane decreases expression EXP 6480464 sulforaphane results in decreased expression of KRT80 mRNA CTD PMID:31838189 KRT80 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of KRT80 mRNA CTD PMID:31533062 KRT80 Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of KRT80 mRNA CTD PMID:31758290 KRT80 Human testosterone increases expression EXP 6480464 Testosterone results in increased expression of KRT80 mRNA CTD PMID:21592394 KRT80 Human testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of KRT80 mRNA CTD PMID:21592394 KRT80 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of KRT80 mRNA CTD PMID:38568856 KRT80 Human titanium dioxide decreases expression ISO RGD:1623931 6480464 titanium dioxide results in decreased expression of KRT80 mRNA CTD PMID:29264374 KRT80 Human trichloroethene decreases expression ISO RGD:1623931 6480464 Trichloroethylene results in decreased expression of KRT80 mRNA CTD PMID:25549359 KRT80 Human trichloroethene increases expression ISO RGD:1359177 6480464 Trichloroethylene results in increased expression of KRT80 mRNA CTD PMID:33387578 KRT80 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of KRT80 gene CTD PMID:29154799 KRT80 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of KRT80 mRNA CTD PMID:23179753 KRT80 Human zoledronic acid decreases expression EXP 6480464 zoledronic acid results in decreased expression of KRT80 mRNA CTD PMID:24714768
(S)-nicotine (EXP) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (EXP) 2-hydroxypropanoic acid (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 7,12-dimethyltetraphene (EXP) actinomycin D (EXP) aflatoxin B1 (EXP) Archazolid B (EXP) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (EXP) bisphenol A (ISO) bisphenol F (ISO) butanal (EXP) cadmium atom (EXP) calcitriol (EXP) carbon nanotube (ISO) cisplatin (EXP) copper atom (EXP) copper(0) (EXP) coumestrol (EXP) cyclophosphamide (EXP) cyclosporin A (EXP) endosulfan (ISO) Enterolactone (EXP) epoxiconazole (ISO) ethanol (EXP) ethylparaben (EXP) etoposide (EXP) furfural (EXP) gentamycin (ISO) hexadecanoic acid (EXP) hydroquinone (EXP) lead diacetate (EXP) lipopolysaccharide (EXP) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) metformin (EXP) methamphetamine (ISO) methoxychlor (ISO) methyl methanesulfonate (EXP) N-nitrosodiethylamine (EXP) nicotine (EXP) okadaic acid (EXP) ozone (ISO) paracetamol (ISO) paraquat (ISO) pentanal (EXP) perfluorooctane-1-sulfonic acid (EXP) propanal (EXP) rac-lactic acid (EXP) S-(1,2-dichlorovinyl)-L-cysteine (EXP) silicon dioxide (EXP) sodium arsenate (EXP) sodium arsenite (EXP) sodium chloride (EXP) sodium dodecyl sulfate (EXP) sodium fluoride (ISO) sulforaphane (EXP) sunitinib (EXP) temozolomide (EXP) testosterone (EXP) thiram (EXP) titanium dioxide (ISO) trichloroethene (ISO) valproic acid (EXP) zoledronic acid (EXP)
KRT80 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 52,168,996 - 52,192,014 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 52,168,996 - 52,192,014 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 52,562,780 - 52,585,798 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 50,849,047 - 50,872,051 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 51,365,224 - 51,388,227 (-) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 49,596,065 - 49,619,064 (-) NCBI HuRef CHM1_1 12 52,529,044 - 52,552,043 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 52,132,581 - 52,155,594 (-) NCBI T2T-CHM13v2.0
Krt80 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 101,246,196 - 101,268,043 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 101,245,325 - 101,268,043 (-) Ensembl GRCm39 Ensembl GRCm38 15 101,348,315 - 101,370,162 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 101,347,444 - 101,370,162 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 101,180,002 - 101,200,556 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 101,175,481 - 101,198,366 (-) NCBI MGSCv36 mm8 Celera 15 103,497,804 - 103,518,340 (-) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 56.78 NCBI
Krt80 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 134,341,951 - 134,363,872 (-) NCBI GRCr8 mRatBN7.2 7 132,463,216 - 132,485,134 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 132,463,218 - 132,485,508 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,266,548 - 134,286,776 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 136,496,053 - 136,516,283 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 136,405,779 - 136,426,014 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 142,995,715 - 143,015,932 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 142,994,119 - 143,016,040 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 140,796,567 - 140,816,784 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 140,096,091 - 140,115,890 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 140,172,527 - 140,192,327 (-) NCBI Celera 7 128,929,953 - 128,950,211 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
Krt80 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955547 2,511,235 - 2,531,630 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955547 2,511,235 - 2,531,631 (-) NCBI ChiLan1.0 ChiLan1.0
KRT80 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 42,003,383 - 42,026,325 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 42,000,161 - 42,023,088 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 36,561,484 - 36,593,887 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 37,348,186 - 37,371,250 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 37,348,186 - 37,371,250 (+) Ensembl panpan1.1 panPan2
KRT80 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 2,862,179 - 2,883,727 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 2,860,735 - 2,884,680 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 43,371,083 - 43,392,776 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 2,860,345 - 2,882,050 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 2,859,091 - 2,882,086 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 2,877,103 - 2,898,785 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 2,863,095 - 2,884,772 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 43,769,282 - 43,790,971 (-) NCBI UU_Cfam_GSD_1.0
Krt80 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 63,565,725 - 63,587,967 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 9,576,851 - 9,599,037 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 9,576,867 - 9,599,050 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KRT80
KRT80 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 48,316,539 - 48,339,552 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 48,315,946 - 48,338,923 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 197,752,635 - 197,775,923 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Krt80
.
Predicted Target Of
Count of predictions: 3321 Count of miRNA genes: 850 Interacting mature miRNAs: 1003 Transcripts: ENST00000313234, ENST00000394815, ENST00000466011 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
SHGC-156072
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 52,581,409 - 52,581,695 UniSTS GRCh37 Build 36 12 50,867,676 - 50,867,962 RGD NCBI36 Celera 12 51,383,852 - 51,384,138 RGD Cytogenetic Map 12 q13.13 UniSTS HuRef 12 49,614,689 - 49,614,975 UniSTS TNG Radiation Hybrid Map 12 24301.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1198
2407
2778
2223
4641
1694
2313
5
597
1378
438
2219
6676
5881
43
3436
1
845
1734
1604
172
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000313234 ⟹ ENSP00000369361
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,168,996 - 52,192,000 (-) Ensembl
Ensembl Acc Id:
ENST00000394815 ⟹ ENSP00000378292
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,168,996 - 52,192,014 (-) Ensembl
Ensembl Acc Id:
ENST00000466011
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,169,523 - 52,185,749 (-) Ensembl
RefSeq Acc Id:
NM_001081492 ⟹ NP_001074961
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 52,168,996 - 52,192,014 (-) NCBI GRCh37 12 52,562,780 - 52,585,798 (-) NCBI Build 36 12 50,849,047 - 50,872,051 (-) NCBI Archive Celera 12 51,365,224 - 51,388,227 (-) RGD HuRef 12 49,596,065 - 49,619,064 (-) RGD CHM1_1 12 52,529,044 - 52,552,043 (-) NCBI T2T-CHM13v2.0 12 52,132,581 - 52,155,594 (-) NCBI
Sequence:
AGTCCCCAGCCCGCCCCAGCTGTGACCAGAGCAACCAGAGCCTGCCACCCGACGCAACCCCAGGCTCACTCGCTCACCCCCCTGGGCCCTCCTGCTTCCGGCCGGGGGCACCATGGCCTGCCGCTCCT
hide sequence
RefSeq Acc Id:
NM_182507 ⟹ NP_872313
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 52,168,996 - 52,192,014 (-) NCBI GRCh37 12 52,562,780 - 52,585,798 (-) NCBI Build 36 12 50,849,047 - 50,872,051 (-) NCBI Archive Celera 12 51,365,224 - 51,388,227 (-) RGD HuRef 12 49,596,065 - 49,619,064 (-) RGD CHM1_1 12 52,529,044 - 52,552,043 (-) NCBI T2T-CHM13v2.0 12 52,132,581 - 52,155,594 (-) NCBI
Sequence:
AGTCCCCAGCCCGCCCCAGCTGTGACCAGAGCAACCAGAGCCTGCCACCCGACGCAACCCCAGGCTCACTCGCTCACCCCCCTGGGCCCTCCTGCTTCCGGCCGGGGGCACCATGGCCTGCCGCTCCT
hide sequence
RefSeq Acc Id:
XM_005268676 ⟹ XP_005268733
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 52,168,996 - 52,185,749 (-) NCBI GRCh37 12 52,562,780 - 52,585,798 (-) NCBI
Sequence:
TCCTGTCCTTATCTCACCATCTTCAGTTTTAACAATCAGTCATTGGAGGTGCTTTCTGCTGAGT
hide sequence
RefSeq Acc Id:
XM_054371193 ⟹ XP_054227168
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 52,132,581 - 52,149,278 (-) NCBI
RefSeq Acc Id:
NP_001074961 ⟸ NM_001081492
- Peptide Label:
isoform K80.1
- UniProtKB:
Q6KB66 (UniProtKB/Swiss-Prot)
- Sequence:
MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDL
hide sequence
RefSeq Acc Id:
NP_872313 ⟸ NM_182507
- Peptide Label:
isoform K80
- UniProtKB:
Q6P1A5 (UniProtKB/Swiss-Prot), Q7Z3Q0 (UniProtKB/Swiss-Prot), Q6KB66 (UniProtKB/Swiss-Prot)
- Sequence:
MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGL
hide sequence
RefSeq Acc Id:
XP_005268733 ⟸ XM_005268676
- Peptide Label:
isoform X1
- Sequence:
MSCHFPGSPPWALAGQPGASAPDWSTPDPFAAFLLSQVQALEQRNQLLETRWSFLQGQDSAIFD
hide sequence
Ensembl Acc Id:
ENSP00000369361 ⟸ ENST00000313234
Ensembl Acc Id:
ENSP00000378292 ⟸ ENST00000394815
RefSeq Acc Id:
XP_054227168 ⟸ XM_054371193
- Peptide Label:
isoform X1
RGD ID: 6790183 Promoter ID: HG_KWN:15684 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3 Transcripts: OTTHUMT00000316758 Position: Human Assembly Chr Position (strand) Source Build 36 12 50,865,821 - 50,866,321 (-) MPROMDB
RGD ID: 6790184 Promoter ID: HG_KWN:15685 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3 Transcripts: NM_001081492, NM_182507 Position: Human Assembly Chr Position (strand) Source Build 36 12 50,871,771 - 50,872,271 (-) MPROMDB
RGD ID: 7223987 Promoter ID: EPDNEW_H17739 Type: initiation region Name: KRT80_1 Description: keratin 80 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H17740 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 12 52,192,014 - 52,192,074 EPDNEW
RGD ID: 7223989 Promoter ID: EPDNEW_H17740 Type: initiation region Name: KRT80_2 Description: keratin 80 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H17739 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 12 52,192,305 - 52,192,365 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-14
KRT80
keratin 80
keratin 80, type II
Symbol and/or name change
5135510 APPROVED
2015-01-27
KRT80
keratin 80, type II
keratin 80
Symbol and/or name change
5135510 APPROVED
