Advanced Search (OLGA)

Gene: TIFA (TRAF interacting protein with forkhead associated domain) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

TIFA

Name:

TRAF interacting protein with forkhead associated domain

RGD ID:

1606192

HGNC Page

HGNC:19075

Description:

Involved in several processes, including cytoplasmic pattern recognition receptor signaling pathway; positive regulation of canonical NF-kappaB signal transduction; and protein homooligomerization. Located in cytoplasm.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

MGC20791; putative MAPK-activating protein PM14; putative NF-kappa-B-activating protein 20; T2BP; T6BP; TIFAA; TRAF-interacting protein with a forkhead-associated domain; TRAF-interacting protein with FHA domain-containing protein A; TRAF-interacting protein with forkhead-associated domain; TRAF2 binding protein; TRAF2-binding protein; TRAF6 binding protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	112,274,537 - 112,285,904 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	112,272,968 - 112,285,955 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	113,195,693 - 113,207,060 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	113,416,231 - 113,426,508 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	110,490,861 - 110,501,136 (-)	NCBI		Celera
Cytogenetic Map	4	q25	NCBI
HuRef	4	108,928,327 - 108,938,602 (-)	NCBI		HuRef
CHM1_1	4	113,173,595 - 113,183,871 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	115,582,899 - 115,594,247 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TIFA	Human	aniridia		IAGP	RGD:11558794	8554872	ClinVar Annotator: match by term: Congenital aniridia	ClinVar
TIFA	Human	Axenfeld-Rieger syndrome type 1		IAGP	RGD:329848937	8554872	ClinVar Annotator: match by term: Axenfeld-Rieger syndrome type 1	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TIFA	Human	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1556897	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TIFA mRNA	CTD	PMID:36331819
TIFA	Human	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1556897	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TIFA mRNA	CTD	PMID:22206623
TIFA	Human	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1556897	6480464	1,2-Dimethylhydrazine results in decreased expression of TIFA mRNA	CTD	PMID:22206623
TIFA	Human	17beta-estradiol	increases expression	ISO	RGD:1556897	6480464	Estradiol results in increased expression of TIFA mRNA	CTD	PMID:39298647
TIFA	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1556897	6480464	Tetrachlorodibenzodioxin results in increased expression of TIFA mRNA	CTD	PMID:19770486
TIFA	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1556897	6480464	Tetrachlorodibenzodioxin affects the expression of TIFA mRNA	CTD	PMID:26377647
TIFA	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1556897	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression more ...	CTD	PMID:25975270
TIFA	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1359151	6480464	Tetrachlorodibenzodioxin results in increased expression of TIFA mRNA	CTD	PMID:21215274\|PMID:33387578\|PMID:34747641
TIFA	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1359151	6480464	Tetrachlorodibenzodioxin affects the expression of TIFA mRNA	CTD	PMID:22298810
TIFA	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1556897	6480464	Tetrachlorodibenzodioxin results in decreased expression of TIFA mRNA	CTD	PMID:21889950
TIFA	Human	4,4'-diaminodiphenylmethane	increases expression	ISO	RGD:1359151	6480464	4,4'-diaminodiphenylmethane results in increased expression of TIFA mRNA	CTD	PMID:30723492
TIFA	Human	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1556897	6480464	bisphenol S results in decreased expression of TIFA mRNA	CTD	PMID:39298647
TIFA	Human	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1556897	6480464	Fenretinide results in increased expression of TIFA mRNA	CTD	PMID:28973697
TIFA	Human	arsane	affects methylation	EXP		6480464	Arsenic affects the methylation of TIFA gene	CTD	PMID:25304211
TIFA	Human	arsenic atom	affects methylation	EXP		6480464	Arsenic affects the methylation of TIFA gene	CTD	PMID:25304211
TIFA	Human	Benoxacor	decreases expression	ISO	RGD:1556897	6480464	benoxacor results in decreased expression of TIFA mRNA	CTD	PMID:34850242
TIFA	Human	benzo[a]pyrene diol epoxide I	decreases expression	EXP		6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of TIFA mRNA	CTD	PMID:20382639
TIFA	Human	benzo[b]fluoranthene	increases expression	ISO	RGD:1556897	6480464	benzo(b)fluoranthene results in increased expression of TIFA mRNA	CTD	PMID:26377693
TIFA	Human	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1556897	6480464	Diethylhexyl Phthalate results in increased expression of TIFA mRNA	CTD	PMID:33754040
TIFA	Human	bisphenol A	decreases expression	ISO	RGD:1556897	6480464	bisphenol A results in decreased expression of TIFA mRNA	CTD	PMID:26063408
TIFA	Human	bisphenol A	increases expression	ISO	RGD:1359151	6480464	bisphenol A results in increased expression of TIFA mRNA	CTD	PMID:25181051
TIFA	Human	cadmium dichloride	increases expression	ISO	RGD:1359151	6480464	Cadmium Chloride results in increased expression of TIFA mRNA	CTD	PMID:25993096
TIFA	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of TIFA mRNA	CTD	PMID:38568856
TIFA	Human	carbon nanotube	increases expression	ISO	RGD:1556897	6480464	Nanotubes, Carbon analog results in increased expression of TIFA mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681\|PMID:25620056
TIFA	Human	CGP 52608	multiple interactions	EXP		6480464	CGP 52608 promotes the reaction [RORA protein binds to TIFA gene]	CTD	PMID:28238834
TIFA	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of TIFA mRNA	CTD	PMID:27594783
TIFA	Human	clothianidin	increases expression	EXP		6480464	clothianidin results in increased expression of TIFA mRNA	CTD	PMID:31626844
TIFA	Human	cobalt dichloride	decreases expression	ISO	RGD:1359151	6480464	cobaltous chloride results in decreased expression of TIFA mRNA	CTD	PMID:24386269
TIFA	Human	Cuprizon	increases expression	ISO	RGD:1359151	6480464	Cuprizone results in increased expression of TIFA mRNA	CTD	PMID:27523638
TIFA	Human	cyclosporin A	increases expression	ISO	RGD:1556897	6480464	Cyclosporine results in increased expression of TIFA mRNA	CTD	PMID:19770486
TIFA	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of TIFA mRNA	CTD	PMID:27989131
TIFA	Human	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of TIFA mRNA	CTD	PMID:25562108
TIFA	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of TIFA mRNA	CTD	PMID:37042841
TIFA	Human	dibutyl phthalate	increases expression	ISO	RGD:1359151	6480464	Dibutyl Phthalate results in increased expression of TIFA mRNA	CTD	PMID:21266533
TIFA	Human	diclofenac	increases expression	ISO	RGD:1556897	6480464	Diclofenac results in increased expression of TIFA mRNA	CTD	PMID:26934552
TIFA	Human	dicrotophos	decreases expression	EXP		6480464	dicrotophos results in decreased expression of TIFA mRNA	CTD	PMID:28302478
TIFA	Human	dimethylarsinic acid	multiple interactions	ISO	RGD:1556897	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
TIFA	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
TIFA	Human	endosulfan	decreases expression	ISO	RGD:1359151	6480464	Endosulfan results in decreased expression of TIFA mRNA	CTD	PMID:29391264
TIFA	Human	entinostat	increases expression	EXP		6480464	entinostat results in increased expression of TIFA mRNA	CTD	PMID:27188386
TIFA	Human	epoxiconazole	affects expression	ISO	RGD:1556897	6480464	epoxiconazole affects the expression of TIFA mRNA	CTD	PMID:35436446
TIFA	Human	ethanol	affects expression	ISO	RGD:1556897	6480464	Ethanol affects the expression of TIFA mRNA	CTD	PMID:30319688
TIFA	Human	fipronil	decreases expression	ISO	RGD:1359151	6480464	fipronil results in decreased expression of TIFA mRNA	CTD	PMID:34044035
TIFA	Human	folic acid	decreases expression	ISO	RGD:1556897	6480464	Folic Acid results in decreased expression of TIFA mRNA	CTD	PMID:25629700
TIFA	Human	folic acid	multiple interactions	ISO	RGD:1556897	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TIFA mRNA	CTD	PMID:22206623
TIFA	Human	formaldehyde	decreases expression	EXP		6480464	Formaldehyde results in decreased expression of TIFA mRNA	CTD	PMID:20655997
TIFA	Human	FR900359	increases phosphorylation	EXP		6480464	FR900359 results in increased phosphorylation of TIFA protein	CTD	PMID:37730182
TIFA	Human	furan	increases expression	ISO	RGD:1359151	6480464	furan results in increased expression of TIFA mRNA	CTD	PMID:27387713
TIFA	Human	genistein	decreases expression	ISO	RGD:1359151	6480464	Genistein results in decreased expression of TIFA protein	CTD	PMID:24552547
TIFA	Human	gentamycin	increases expression	ISO	RGD:1359151	6480464	Gentamicins results in increased expression of TIFA mRNA	CTD	PMID:22061828
TIFA	Human	hypochlorous acid	decreases expression	ISO	RGD:1556897	6480464	Hypochlorous Acid results in decreased expression of TIFA mRNA	CTD	PMID:19376150
TIFA	Human	ketamine	increases expression	ISO	RGD:1359151	6480464	Ketamine results in increased expression of TIFA mRNA	CTD	PMID:20080153
TIFA	Human	lipopolysaccharide	increases expression	ISO	RGD:1556897	6480464	Lipopolysaccharides results in increased expression of TIFA mRNA	CTD	PMID:27339419
TIFA	Human	lipopolysaccharide	multiple interactions	EXP		6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TIFA mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
TIFA	Human	lipopolysaccharide	increases expression	EXP		6480464	Lipopolysaccharides results in increased expression of TIFA mRNA	CTD	PMID:18192897\|PMID:35811015
TIFA	Human	methylarsonic acid	multiple interactions	ISO	RGD:1556897	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
TIFA	Human	orphenadrine	affects expression	ISO	RGD:1359151	6480464	Orphenadrine affects the expression of TIFA mRNA	CTD	PMID:23665939
TIFA	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1556897	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TIFA mRNA	CTD	PMID:36331819
TIFA	Human	phenobarbital	increases expression	ISO	RGD:1556897	6480464	Phenobarbital results in increased expression of TIFA mRNA	CTD	PMID:19270015
TIFA	Human	phenylmercury acetate	increases expression	EXP		6480464	Phenylmercuric Acetate results in increased expression of TIFA mRNA	CTD	PMID:26272509
TIFA	Human	phenylmercury acetate	multiple interactions	EXP		6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
TIFA	Human	pirinixic acid	decreases expression	ISO	RGD:1556897	6480464	pirinixic acid results in decreased expression of TIFA mRNA	CTD	PMID:17426115\|PMID:20813756\|PMID:23811191
TIFA	Human	potassium chromate	decreases expression	EXP		6480464	potassium chromate(VI) results in decreased expression of TIFA mRNA	CTD	PMID:22714537
TIFA	Human	protein kinase inhibitor	multiple interactions	EXP		6480464	Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of TIFA mRNA]	CTD	PMID:28003376
TIFA	Human	quercetin	decreases expression	EXP		6480464	Quercetin results in decreased expression of TIFA mRNA	CTD	PMID:21632981
TIFA	Human	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	EXP		6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TIFA mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
TIFA	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
TIFA	Human	silicon dioxide	decreases expression	ISO	RGD:1556897	6480464	Silicon Dioxide results in decreased expression of TIFA mRNA	CTD	PMID:19073995\|PMID:33720480
TIFA	Human	silicon dioxide	increases expression	ISO	RGD:1556897	6480464	Silicon Dioxide results in increased expression of TIFA mRNA	CTD	PMID:23221170
TIFA	Human	silver atom	decreases expression	EXP		6480464	Silver results in decreased expression of TIFA mRNA	CTD	PMID:26014281
TIFA	Human	silver(0)	decreases expression	EXP		6480464	Silver results in decreased expression of TIFA mRNA	CTD	PMID:26014281
TIFA	Human	sodium arsenate	multiple interactions	ISO	RGD:1556897	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
TIFA	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of TIFA mRNA	CTD	PMID:38568856
TIFA	Human	sodium arsenite	multiple interactions	ISO	RGD:1556897	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
TIFA	Human	sodium dichromate	affects expression	ISO	RGD:1359151	6480464	sodium bichromate affects the expression of TIFA mRNA	CTD	PMID:22110744
TIFA	Human	Soman	increases expression	ISO	RGD:1359151	6480464	Soman results in increased expression of TIFA mRNA	CTD	PMID:19281266
TIFA	Human	succimer	multiple interactions	ISO	RGD:1556897	6480464	[Succimer binds to Magnetite Nanoparticles] which results in decreased expression of TIFA mRNA	CTD	PMID:21641980
TIFA	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of TIFA mRNA	CTD	PMID:31533062
TIFA	Human	tamoxifen	affects expression	ISO	RGD:1556897	6480464	Tamoxifen affects the expression of TIFA mRNA	CTD	PMID:20937368
TIFA	Human	tetraphene	increases expression	ISO	RGD:1556897	6480464	benz(a)anthracene results in increased expression of TIFA mRNA	CTD	PMID:26377693
TIFA	Human	thioacetamide	increases expression	ISO	RGD:1359151	6480464	Thioacetamide results in increased expression of TIFA mRNA	CTD	PMID:34492290
TIFA	Human	titanium dioxide	decreases expression	ISO	RGD:1556897	6480464	titanium dioxide results in decreased expression of TIFA mRNA	CTD	PMID:29264374
TIFA	Human	trichloroethene	increases expression	ISO	RGD:1359151	6480464	Trichloroethylene results in increased expression of TIFA mRNA	CTD	PMID:33387578
TIFA	Human	trichostatin A	increases expression	EXP		6480464	trichostatin A results in increased expression of TIFA mRNA	CTD	PMID:24935251\|PMID:26272509\|PMID:27188386
TIFA	Human	trichostatin A	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
TIFA	Human	urethane	decreases expression	EXP		6480464	Urethane results in decreased expression of TIFA mRNA	CTD	PMID:28818685
TIFA	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of TIFA mRNA	CTD	PMID:25979313
TIFA	Human	valproic acid	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
TIFA	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of TIFA mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:28001369
TIFA	Human	vanadyl sulfate	decreases expression	EXP		6480464	vanadyl sulfate results in decreased expression of TIFA mRNA	CTD	PMID:16330358
TIFA	Human	vinclozolin	increases methylation	ISO	RGD:1359151	6480464	vinclozolin results in increased methylation of TIFA gene	CTD	PMID:31682807
TIFA	Human	vorinostat	increases expression	EXP		6480464	vorinostat results in increased expression of TIFA mRNA	CTD	PMID:27188386
TIFA	Human	zoledronic acid	increases expression	EXP		6480464	zoledronic acid results in increased expression of TIFA mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TIFA	Human	cytoplasmic pattern recognition receptor signaling pathway	involved_in	IDA		150520179	PMID:26068852, PMID:28222186, PMID:28877472, PMID:30111836	UniProt	PMID:26068852\|PMID:28222186\|PMID:28877472\|PMID:30111836
TIFA	Human	cytoplasmic pattern recognition receptor signaling pathway	involved_in	IBA	PANTHER:PTN001262109\|UniProtKB:Q96CG3	150520179		GO_Central	GO_REF:0000033
TIFA	Human	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	150520179		UniProt	GO_REF:0000043
TIFA	Human	innate immune response	involved_in	IEA	UniProtKB-KW:KW-0399	150520179		UniProt	GO_REF:0000043
TIFA	Human	innate immune response	involved_in	IBA	PANTHER:PTN001262109\|UniProtKB:Q96CG3	150520179		GO_Central	GO_REF:0000033
TIFA	Human	innate immune response	involved_in	IDA		150520179	PMID:26068852, PMID:28222186, PMID:28877472, PMID:30111836	UniProt	PMID:26068852\|PMID:28222186\|PMID:28877472\|PMID:30111836
TIFA	Human	positive regulation of canonical NF-kappaB signal transduction	involved_in	IEA	InterPro:IPR033621	150520179		InterPro	GO_REF:0000002
TIFA	Human	positive regulation of canonical NF-kappaB signal transduction	involved_in	IEA	UniProtKB:Q793I8\|ensembl:ENSMUSP00000127700	150520179		Ensembl	GO_REF:0000107
TIFA	Human	positive regulation of canonical NF-kappaB signal transduction	involved_in	IBA	MGI:2182965\|PANTHER:PTN001262109\|UniProtKB:Q96CG3	150520179		GO_Central	GO_REF:0000033
TIFA	Human	positive regulation of canonical NF-kappaB signal transduction	involved_in	IDA		150520179	PMID:26068852, PMID:28222186, PMID:28877472, PMID:30111836	UniProt	PMID:26068852\|PMID:28222186\|PMID:28877472\|PMID:30111836
TIFA	Human	protein homooligomerization	involved_in	IDA		150520179	PMID:22566686	UniProt	PMID:22566686
TIFA	Human	tumor necrosis factor-mediated signaling pathway	involved_in	IEA	UniProtKB:Q793I8\|ensembl:ENSMUSP00000127700	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TIFA	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
TIFA	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
TIFA	Human	cytoplasm	located_in	IDA		150520179	PMID:22566686	UniProt	PMID:22566686
TIFA	Human	cytoplasm	is_active_in	IBA	PANTHER:PTN001262109\|UniProtKB:Q96CG3	150520179		GO_Central	GO_REF:0000033
TIFA	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-9645394\|Reactome:R-HSA-9645406\|Reactome:R-HSA-9645414\|Reactome:R-HSA-9645442\|Reactome:R-HSA-9645481\|Reactome:R-HSA-9645501\|Reactome:R-HSA-9645520\|Reactome:R-HSA-9645524\|Reactome:R-HSA-9645535\|Reactome:R-HSA-9758604

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TIFA	Human	protein binding	enables	IPI	UniProtKB:P57055	150520179	PMID:33961781	IntAct	PMID:33961781
TIFA	Human	protein binding	enables	IPI	UniProtKB:Q96QP1	150520179	PMID:30111836	UniProt	PMID:30111836
TIFA	Human	protein binding	enables	IPI	UniProtKB:O00560\|UniProtKB:O60443\|UniProtKB:P32969\|UniProtKB:P54646\|UniProtKB:P57055\|UniProtKB:Q12933\|UniProtKB:Q63ZY3\|UniProtKB:Q96HA8\|UniProtKB:Q9BXS5\|UniProtKB:Q9UBU9	150520179	PMID:32296183	IntAct	PMID:32296183
TIFA	Human	protein binding	enables	IPI	UniProtKB:Q8N4T4	150520179	PMID:31515488	IntAct	PMID:31515488
TIFA	Human	protein binding	enables	IPI	UniProtKB:Q5TAX3-1	150520179	PMID:16643855	IntAct	PMID:16643855
TIFA	Human	protein binding	enables	IPI	UniProtKB:O14641\|UniProtKB:Q12933\|UniProtKB:Q9BXS5\|UniProtKB:Q9H190	150520179	PMID:16189514	IntAct	PMID:16189514
TIFA	Human	protein binding	enables	IPI	UniProtKB:Q6ZNK6	150520179	PMID:32101751	IntAct	PMID:32101751
TIFA	Human	protein binding	enables	IPI	UniProtKB:Q12933	150520179	PMID:11798190	IntAct	PMID:11798190
TIFA	Human	protein binding	enables	IPI	UniProtKB:O00560\|UniProtKB:O95379\|UniProtKB:P32969\|UniProtKB:Q12933\|UniProtKB:Q8N4T4\|UniProtKB:Q99757\|UniProtKB:Q9BXS5\|UniProtKB:Q9H190\|UniProtKB:Q9UBU9	150520179	PMID:25416956	IntAct	PMID:25416956
TIFA	Human	protein binding	enables	IPI	UniProtKB:Q9Y4K3	150520179	PMID:26068852	IntAct	PMID:26068852
TIFA	Human	protein binding	enables	IPI	UniProtKB:P70196\|UniProtKB:Q6ZNK6	150520179	PMID:15047173	IntAct	PMID:15047173
TIFA	Human	protein binding	enables	IPI	UniProtKB:O00560\|UniProtKB:O14641\|UniProtKB:Q9H190\|UniProtKB:Q9Y4K3	150520179	PMID:27107012	IntAct	PMID:27107012

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:11798190	PMID:12477932	PMID:12566447	PMID:12761501	PMID:15047173	PMID:15492226	PMID:16189514	PMID:16643855	PMID:19322201	PMID:20332099	PMID:21516116
PMID:21873635	PMID:22566686	PMID:25416956	PMID:26068852	PMID:26389808	PMID:26501855	PMID:27107012	PMID:27107014	PMID:27217568	PMID:27965388	PMID:28069801	PMID:28222186
PMID:28514442	PMID:28514661	PMID:28715499	PMID:28811347	PMID:28877472	PMID:29263897	PMID:29337150	PMID:29581234	PMID:29975933	PMID:30111836	PMID:30378729	PMID:31123889
PMID:31515488	PMID:32101751	PMID:32296183	PMID:32393512	PMID:32910997	PMID:33037203	PMID:33961781	PMID:34238983	PMID:34328245	PMID:35089437	PMID:35635239	PMID:36098982
PMID:36586274	PMID:36965415

TIFA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	112,274,537 - 112,285,904 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	112,272,968 - 112,285,955 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	113,195,693 - 113,207,060 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	113,416,231 - 113,426,508 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	110,490,861 - 110,501,136 (-)	NCBI		Celera
Cytogenetic Map	4	q25	NCBI
HuRef	4	108,928,327 - 108,938,602 (-)	NCBI		HuRef
CHM1_1	4	113,173,595 - 113,183,871 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	115,582,899 - 115,594,247 (-)	NCBI		T2T-CHM13v2.0

Tifa
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	127,582,524 - 127,592,043 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	127,583,454 - 127,625,813 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	127,788,875 - 127,798,394 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	127,789,805 - 127,832,164 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	127,492,831 - 127,501,307 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	127,781,941 - 127,800,104 (+)	NCBI		MGSCv36	mm8
MGSCv36	3	128,273,227 - 128,291,450 (+)	NCBI		MGSCv36	mm8
Celera	3	134,292,137 - 134,300,604 (+)	NCBI		Celera
Cytogenetic Map	3	G2	NCBI
cM Map	3	56.54	NCBI

Tifa
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	218,927,724 - 218,942,111 (+)	NCBI		GRCr8
mRatBN7.2	2	216,257,926 - 216,267,635 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	216,234,774 - 216,267,841 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	223,922,080 - 223,931,305 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	221,821,777 - 221,831,000 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	216,675,867 - 216,685,087 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	232,104,394 - 232,137,425 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	232,104,809 - 232,137,422 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	251,423,679 - 251,482,346 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	225,067,695 - 225,076,898 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	225,054,374 - 225,063,575 (+)	NCBI
Celera	2	208,569,719 - 208,578,933 (+)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

Tifa
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955457	14,444,814 - 14,450,767 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955457	14,444,811 - 14,460,168 (+)	NCBI	ChiLan1.0	ChiLan1.0

TIFA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	110,350,189 - 110,362,391 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	110,637,766 - 110,655,760 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	104,765,007 - 104,776,217 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	115,328,436 - 115,338,732 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

TIFA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	32,125,870 - 32,135,159 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	32,126,634 - 32,127,191 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	9,896,747 - 9,907,233 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	32,349,595 - 32,360,055 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	32,349,597 - 32,359,545 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	32,332,694 - 32,343,179 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	32,093,596 - 32,104,107 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	7,757,210 - 7,767,777 (+)	NCBI		UU_Cfam_GSD_1.0

Tifa
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	8,750,214 - 8,757,559 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936563	3,152,049 - 3,158,999 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936563	3,151,515 - 3,159,071 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TIFA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	110,377,892 - 110,389,604 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	110,377,817 - 110,394,190 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	118,358,074 - 118,366,203 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TIFA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	60,074,764 - 60,085,029 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	60,076,999 - 60,077,556 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	38,834,354 - 38,846,161 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tifa
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624838	6,160,712 - 6,167,408 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in TIFA
10 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 4q22.2-32.3(chr4:92913386-165299707)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051775]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051775]\|See cases [RCV000051775]	Chr4:92913386..165299707 [GRCh38] Chr4:93834537..166220859 [GRCh37] Chr4:94053560..166440309 [NCBI36] Chr4:4q22.2-32.3	pathogenic
GRCh38/hg38 4q22.3-28.3(chr4:96092893-136410207)x3	copy number gain	See cases [RCV000051776]	Chr4:96092893..136410207 [GRCh38] Chr4:97014044..137331362 [GRCh37] Chr4:97233067..137550812 [NCBI36] Chr4:4q22.3-28.3	pathogenic
GRCh38/hg38 4q25-26(chr4:111069785-116691879)x1	copy number loss	See cases [RCV000134955]	Chr4:111069785..116691879 [GRCh38] Chr4:111990941..117613035 [GRCh37] Chr4:112210390..117832483 [NCBI36] Chr4:4q25-26	likely pathogenic
NC_000004.10:g.111994000_115504000del3510001	deletion	Congenital aniridia [RCV000257787]	Chr4:110853395..114363395 [GRCh38] Chr4:111774551..115284551 [GRCh37] Chr4:111994000..115504000 [NCBI36] Chr4:4q25-26	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:12440-190904441)x3	copy number gain	See cases [RCV000446653]	Chr4:12440..190904441 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q25-26(chr4:112857598-115434654)x1	copy number loss	See cases [RCV000448547]	Chr4:112857598..115434654 [GRCh37] Chr4:4q25-26	likely pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:68346-190957473)	copy number gain	See cases [RCV000510453]	Chr4:68346..190957473 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q25-35.2(chr4:109199664-189752726)x3	copy number gain	See cases [RCV000511945]	Chr4:109199664..189752726 [GRCh37] Chr4:4q25-35.2	pathogenic
GRCh37/hg19 4q22.1-35.2(chr4:93071152-190957473)x3	copy number gain	See cases [RCV000510970]	Chr4:93071152..190957473 [GRCh37] Chr4:4q22.1-35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:68346-190957473)x3	copy number gain	See cases [RCV000512241]	Chr4:68346..190957473 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q25(chr4:112901280-113403129)x1	copy number loss	not provided [RCV000682445]	Chr4:112901280..113403129 [GRCh37] Chr4:4q25	uncertain significance
GRCh37/hg19 4p16.3-q35.2(chr4:49450-190915650)x3	copy number gain	not provided [RCV000743155]	Chr4:49450..190915650 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q25(chr4:113175966-113835185)x1	copy number loss	not provided [RCV000743921]	Chr4:113175966..113835185 [GRCh37] Chr4:4q25	uncertain significance
GRCh37/hg19 4p16.3-q35.2(chr4:49450-190963766)x3	copy number gain	not provided [RCV000743156]	Chr4:49450..190963766 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:11525-191028879)x3	copy number gain	not provided [RCV000743147]	Chr4:11525..191028879 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q25(chr4:113116277-113602286)x3	copy number gain	not provided [RCV000847514]	Chr4:113116277..113602286 [GRCh37] Chr4:4q25	uncertain significance
GRCh37/hg19 4q25(chr4:111334313-113223858)x1	copy number loss	not provided [RCV001259302]	Chr4:111334313..113223858 [GRCh37] Chr4:4q25	pathogenic
GRCh37/hg19 4q25(chr4:112481911-113756889)	copy number gain	Neurodevelopmental delay [RCV002280697]	Chr4:112481911..113756889 [GRCh37] Chr4:4q25	uncertain significance
GRCh37/hg19 4q24-31.21(chr4:104715235-145252595)	copy number gain	not specified [RCV002053446]	Chr4:104715235..145252595 [GRCh37] Chr4:4q24-31.21	pathogenic
GRCh37/hg19 4q12-31.21(chr4:52866944-143582507)x3	copy number gain	not provided [RCV001827738]	Chr4:52866944..143582507 [GRCh37] Chr4:4q12-31.21	pathogenic
GRCh37/hg19 4q25-26(chr4:112849108-115434557)	copy number loss	not specified [RCV002053449]	Chr4:112849108..115434557 [GRCh37] Chr4:4q25-26	likely pathogenic
NM_052864.3(TIFA):c.82T>G (p.Cys28Gly)	single nucleotide variant	not specified [RCV004085406]	Chr4:112278335 [GRCh38] Chr4:113199491 [GRCh37] Chr4:4q25	uncertain significance
NM_052864.3(TIFA):c.248T>A (p.Leu83His)	single nucleotide variant	not specified [RCV004238919]	Chr4:112278169 [GRCh38] Chr4:113199325 [GRCh37] Chr4:4q25	uncertain significance
NM_052864.3(TIFA):c.292G>A (p.Val98Met)	single nucleotide variant	not specified [RCV004176029]	Chr4:112278125 [GRCh38] Chr4:113199281 [GRCh37] Chr4:4q25	uncertain significance
NC_000004.12:g.110650730_112833790del	deletion	Axenfeld-Rieger syndrome type 1 [RCV003225703]	Chr4:110650730..112833790 [GRCh38] Chr4:4q25	likely pathogenic
NM_052864.3(TIFA):c.331C>A (p.Leu111Met)	single nucleotide variant	not specified [RCV004346680]	Chr4:112278086 [GRCh38] Chr4:113199242 [GRCh37] Chr4:4q25	uncertain significance
GRCh37/hg19 4q24-35.2(chr4:101203509-190957473)x3	copy number gain	not specified [RCV003986496]	Chr4:101203509..190957473 [GRCh37] Chr4:4q24-35.2	pathogenic
GRCh37/hg19 4p12-q35.2(chr4:45455621-191003541)x3	copy number gain	not provided [RCV003885507]	Chr4:45455621..191003541 [GRCh37] Chr4:4p12-q35.2	pathogenic
NM_052864.3(TIFA):c.182A>G (p.Gln61Arg)	single nucleotide variant	not specified [RCV004686812]	Chr4:112278235 [GRCh38] Chr4:113199391 [GRCh37] Chr4:4q25	uncertain significance
NM_052864.3(TIFA):c.184G>A (p.Asp62Asn)	single nucleotide variant	not specified [RCV004676914]	Chr4:112278233 [GRCh38] Chr4:113199389 [GRCh37] Chr4:4q25	uncertain significance
NM_052864.3(TIFA):c.64C>A (p.His22Asn)	single nucleotide variant	not specified [RCV004870059]	Chr4:112278353 [GRCh38] Chr4:113199509 [GRCh37] Chr4:4q25	uncertain significance
NM_052864.3(TIFA):c.443T>A (p.Leu148His)	single nucleotide variant	not specified [RCV004870060]	Chr4:112277974 [GRCh38] Chr4:113199130 [GRCh37] Chr4:4q25	uncertain significance
NM_052864.3(TIFA):c.320A>G (p.Asn107Ser)	single nucleotide variant	not specified [RCV004870061]	Chr4:112278097 [GRCh38] Chr4:113199253 [GRCh37] Chr4:4q25	uncertain significance
NM_052864.3(TIFA):c.442C>G (p.Leu148Val)	single nucleotide variant	not specified [RCV004870058]	Chr4:112277975 [GRCh38] Chr4:113199131 [GRCh37] Chr4:4q25	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	964
Count of miRNA genes:	622
Interacting mature miRNAs:	677
Transcripts:	ENST00000361717, ENST00000500655
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1643256	BW127_H	Body Weight QTL 127 (human)	1.31	0.007	Body weight	body mass index	4	106319694	132319694	Human

D4S2756

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	113,198,272 - 113,198,392	UniSTS	GRCh37
Build 36	4	113,417,721 - 113,417,841	RGD	NCBI36
Celera	4	110,492,351 - 110,492,471	RGD
Cytogenetic Map	4	q25	UniSTS
HuRef	4	108,929,817 - 108,929,937	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2252	4972	1726	2351	6	624	1951	465	2269	7305	6471	53	3732	1	852	1744	1617	174	1


RefSeq Transcripts	NM_052864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054351250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB062110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB097011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB097038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC109347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK292900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC008294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC014259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM680110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BM718895	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CA772080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000361717 ⟹ ENSP00000354911

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	4	112,274,537 - 112,285,904 (-)	Ensembl

Ensembl Acc Id:

ENST00000500655 ⟹ ENSP00000424231

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	4	112,277,759 - 112,281,773 (-)	Ensembl

Ensembl Acc Id:

ENST00000610220 ⟹ ENSP00000516322

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	4	112,272,968 - 112,285,955 (-)	Ensembl

RefSeq Acc Id:

NM_052864 ⟹ NP_443096

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	112,274,537 - 112,285,904 (-)	NCBI
GRCh37	4	113,196,782 - 113,207,059 (-)	RGD
Build 36	4	113,416,231 - 113,426,508 (-)	NCBI Archive
Celera	4	110,490,861 - 110,501,136 (-)	RGD
HuRef	4	108,928,327 - 108,938,602 (-)	RGD
CHM1_1	4	113,173,595 - 113,183,871 (-)	NCBI
T2T-CHM13v2.0	4	115,582,899 - 115,594,247 (-)	NCBI

Sequence:

show sequence

CTTTACAAAGGCCCCGGGCGCGAGAGGACGTGCTCTGCCAGCCAGTGGGAAGGCAGGCCGCGCGCGCGGGAGCGCGGGAGGATCGGCGGCTCGCGGTCACTGGTCCCTGGCTCGGTTCCCCGCACCCC
GGGGCTCACACTTACCCGCGCGGAGGAGCAGCGGCCGGGTGTCCACCCCCATCCTGCGCCCAGTCTCCTCGATTCCCCTCGCTCTGAGCCGGGAGAGCCGAACAGCTGAAGAGAGTTCACTGACTCCC
CAGCCCCAGGTGGGCCTTGTGCACATCATGACCAGTTTTGAAGATGCTGACACAGAAGAGACAGTAACTTGTCTCCAGATGACGGTTTACCATCCTGGCCAGTTGCAGTGTGGAATATTTCAGTCAAT
AAGTTTTAACAGAGAGAAACTCCCTTCCAGCGAAGTGGTGAAATTTGGCCGAAATTCCAACATCTGTCATTATACTTTTCAGGACAAACAGGTTTCCCGAGTTCAGTTTTCTCTGCAGCTGTTTAAAA
AATTCAACAGCTCAGTTCTCTCCTTTGAAATAAAAAATATGAGTAAAAAGACCAATCTGATCGTGGACAGCAGAGAGCTGGGCTACCTAAATAAAATGGACCTGCCATACAGGTGCATGGTCAGATTC
GGAGAGTATCAGTTTCTGATGGAGAAGGAAGATGGCGAGTCATTGGAATTTTTTGAGACTCAATTTATTTTATCTCCAAGATCACTCTTGCAAGAAAACAACTGGCCACCACACAGGCCCATACCGGA
GTATGGCACTTATTCGCTCTGCTCCTCCCAAAGCAGTTCTCCGACAGAAATGGATGAAAATGAGTCATGAACACAGAAAGTCTAAGAGGAGAAATATGATGGATGAAGAGCTCTGTAGATGCTGTATA
GACACTAAATAAGAGTTGATTAGGGTAGTATATTATAGTCATCTGTTATGCTGTGAAATTTGGAATTCAGTATTATCATTTTGAAGTCTGTAAATTGTGTTAGTCATTAACTTAGTCACCTGTTGTAT
TCTGGATCTACACAAAATTATTTTAACTGCTCTTATTAATCTGTGAGGATTAATATACAAAAAGTATCCTTTGAGATGAAGTCGTGTTCTCAAAATAAGGTTATATTATTTTCTTTTTCTGCTTGATT
TTCATCTTGTGTTTTGCTTTGTTTTTGTAAGGAACCATCTCTTGGTTTGGTCACATCAGTTCACAACAGCCATTTGTTTTCAAGGTCAAGGCTCCAGGCAGGTTGTTACTGGTGTTTGCAGCCTGTCA
GTACTTGCAGTACTGGAATAGGTTCTAGGCTAGTGTCTGCGCGTCACTGTGGTTTTAGCATGGGAGGACTTATTTGAGAAATACTACCTTACTTTTCTATGATTTCTTTTTACAGAGTTATAGTGTGT
TTACTCCTAAGATGACAGTTCTCTTTGTCTATATTCAGCATCTAAGACAAATATTTAAACATTTTAAAGAACCACTGTGTTAAGTTTAGGATTATTTACTTACCAAATTAGAAGTTTGACTTTTATGT
GTTATACACAATCTTAAAATTTCACGAATTCACCTTTTTAATAGTATCCATGTACATAATAAAATCAAAGTTTAATTAGCCATTTTCTTTGAATTTTTTTCTAAATAAGGGAAATAACTGTTCTTGGG
CCACTTTACAGAGATAAATGTATGTGAATGTTTATGATAAACGCTTAAATATTTCTAAAATATTAACTTCAAAAAAGTCTTTTTCAGTTCTTAAATAAAAATTTATTTATTTAAGATACTTATTCGAC
TTATCTTAACTAAGGTAGCTATGAATGTTAAGTAGATGAGGTAACCATTCAGTTAAGTTAAATTGTAGCATTGCCAGGTAGTGAGGCTCACTGTACAATTTTCCAGGTAAATGAAATTTCCTGTAGTA
AGAGGTCCGTATTTTTGTAACAGCCTTTTAAAAATGCTTTTGGGAACCCTCCAGCCTCTTACCAAAAGAGGCTTTAAACCTCATCTTGATTCAGACTGTCAGTCTATTCCTGGGCAGTAGTATGTGAT
GTCCAGCACCCTAACCCCGACTCCCCAGCCCTGGGACTATTCCAGTAGAGTGAAATATTTGTCCCTGTACAAAGTGGCCTGAATGACTGTTGGAGTTCCTGTGTCTGGTTTTCCTGTTTATTCCCTGT
GATGCCCAGAGTAATGGCCCATCCAAAGATGTCCAGATGTCCATGTGCTAGTCTCCAGAACTTGTAACTGTGTTGTTATGTGGCAAAGGGGAATGAAGGCTGCAGATGGAAGTAAAATAGATTATGCT
GGATTATCTGGGTGTGCCCAATTGATCACCGGATCCGTAAAAGTGGAAGAGAGGCAGATCAGGATGTCAGCGTGATGAGGTGTGAGACAGACTTGACTTGCTGTTGCTGGGAGGAAGGGGAGGTCATG
AGCCAAGGAATGTGGACAGTCTCTTGAAGCTGGAAAGTGTGCATTGGACATCTGGAAGCCAGAAAAGACAAAGAAATATCCAGAAAGGAACAAAGTCTTGTGGACACCTTGATTTTGGTCCAGTGAGA
ATATGTTTGACTTGTTAACCTACAAAACTTTATGATGATAAATTTGTGTTGGTCGTAAGCCACTAAATCACAGTAATTTGTTATAGCAGCAGATAGAAAACTAATATACTCCCTTTAATATAAGGTTA
TCTACTATTGATTCTTTCTAGGATTTTAGCTTCTGGTCTGATGTGGGTTTACAGCCAGATCACCCGGCTTGAATTGCTTACAGTGTGTAGTCTCATGGTAAAGGCGTTCTATGAGTGAAGTGTATATA
CTTTAATGTGTGTATACTGTCACATTTTGACTATTTTGGAAGACTTTCACCTCTGTTTCTTGTCTTTGAGGCTGATGAATGTGTTTCTAAGTTATAAATTTAATATTAAGGGATTCATGTATTATTGT
TATTGAATCCAAACAATGTGTTAAGTAATATTTAGGGCCAGAAAAATCTTGTACAGAATAATGATTTCTCCTAATGTAAATCTTGGAAAGGGTTTTGTTCAACTTGAGAAATATTAAATTTTTTATTC
TATTTTCTTTTCTTCAAAGATTGGCAAAGGAGAGAGTGGGTTGCTAAAAGTTTATATTGTTCTCCAAAGAATAGAAACACTTTCCATAGCCCAACTCCGGTAGTAAATAATAATGAACGCTTTAATAA
TGAAAGAGCAATTGGTTAGTATTAGAATTGTTTTGATTACAAAGTTAGCATCTCTGCCTGAGCTACCCAACCCCAAAGCGGGGTTGTTAGAGGAAAGCTACCATATTTCATAGAACCGAGGAAGGAAT
GCAGCAGACCTCAGGTGAGATTCGAATGCTCTGGCTCTGACCCTCAATGCATATTGGCTCCATGGCCACCTGTAGCTCCCAAGTTTTACACGTTATTGATCCCCCAAAGAGACCTGATCTCTTGATTT
CAGTTCCAGGGACGGGTCAGCTTGGGTCAGGTGCCCACCCCTTCACCAATCAACTTGTCTCAGGTAACGCAGTCACATTATATAATGGCTGCTCTGGTCAGTGATCATGTGGATAGATACAGCATTTT
CTCAAAAAAATGGTCACAGGGGTGGGGGTGGGGCAAACAAAAATATTGGTGTTTGATACAAGGTACTGAAGCTAAGATGTGAAACCTTCCATATACACTTTAAGGACTTCTTTGTCCCTGGAAAGTGA
TTTTTCTGGGGCTCCTTAGGTAGAGAGGTGTATTAATGGTGCCAGTGTTAGAATCCTTGGCAGTCTCTTCTTGAACCTGCAACTCCAGTGGTTAAATCTCATAGGCCATATAACCATTTTCTAGAGAA
TTCTGTTCCTACTATCTAATGCAGTAACTGACTTAAAAGTAAGTATTACTGTTAGACTCTAACATAAGTGGTGGTATTTGTTTTAATGGAGGTGGGATCAGGTATGTGTTCACTTAAGCTTTACATTA
AAAAAAAATTTATATGTGTAAATAAATATATATGCCTTGTAGAAAAATTAGCCATAATCTTACTACCAGAAGAGAACTACTGTTAACTTTGTGTGTGTGTATATGTGGTGGATGGTTTTATGTTACCT
CCTGGCTCTTTTTATGTTTCCAATTCTCTAACACTTGTTTAATTAATTACTTATATTATTAAGATAA

hide sequence

RefSeq Acc Id:

XM_054351250 ⟹ XP_054207225

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	4	115,582,899 - 115,590,056 (-)	NCBI


Protein RefSeqs	NP_443096	(Get FASTA)	NCBI Sequence Viewer
	XP_054207225	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH08294	(Get FASTA)	NCBI Sequence Viewer
	AAH14259	(Get FASTA)	NCBI Sequence Viewer
	AAY40963	(Get FASTA)	NCBI Sequence Viewer
	BAB86902	(Get FASTA)	NCBI Sequence Viewer
	BAC77364	(Get FASTA)	NCBI Sequence Viewer
	BAC77391	(Get FASTA)	NCBI Sequence Viewer
	BAF85589	(Get FASTA)	NCBI Sequence Viewer
	EAX06273	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000354911
	ENSP00000354911.2
	ENSP00000424231.1
	ENSP00000516322.1
GenBank Protein	Q96CG3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_443096 ⟸ NM_052864
- UniProtKB:	Q96CG3 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEK EDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES hide sequence

Ensembl Acc Id:

ENSP00000354911 ⟸ ENST00000361717

Ensembl Acc Id:

ENSP00000424231 ⟸ ENST00000500655

Ensembl Acc Id:

ENSP00000516322 ⟸ ENST00000610220

RefSeq Acc Id:	XP_054207225 ⟸ XM_054351250
- Peptide Label:	isoform X1
- UniProtKB:	Q96CG3 (UniProtKB/Swiss-Prot)

Protein Domains

FHA

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q96CG3-F1-model_v2	AlphaFold	Q96CG3	1-184	view protein structure

RGD ID:

6868292

Promoter ID:

EPDNEW_H7311

Type:

initiation region

Name:

TIFA_1

Description:

TRAF interacting protein with forkhead associated domain

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	112,285,904 - 112,285,964	EPDNEW

RGD ID:

6802662

Promoter ID:

HG_KWN:48929

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

K562, Lymphoblastoid

Transcripts:

UC010IMN.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	4	113,418,501 - 113,419,962 (-)	MPROMDB

RGD ID:

6802660

Promoter ID:

HG_KWN:48930

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

NM_052864

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	4	113,426,286 - 113,426,786 (-)	MPROMDB

Database	Acc Id	Source(s)
COSMIC	TIFA	COSMIC
Ensembl Genes	ENSG00000145365	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000361717	ENTREZGENE
	ENST00000361717.4	UniProtKB/Swiss-Prot
	ENST00000500655.2	UniProtKB/Swiss-Prot
	ENST00000610220.2	UniProtKB/Swiss-Prot
GTEx	ENSG00000145365	GTEx
HGNC ID	HGNC:19075	ENTREZGENE
Human Proteome Map	TIFA	Human Proteome Map
InterPro	FHA_dom	UniProtKB/Swiss-Prot
	SMAD_FHA_dom_sf	UniProtKB/Swiss-Prot
	TIFA	UniProtKB/Swiss-Prot
KEGG Report	hsa:92610	UniProtKB/Swiss-Prot
NCBI Gene	92610	ENTREZGENE
OMIM	609028	OMIM
PANTHER	PTHR31266	UniProtKB/Swiss-Prot
	TRAF-INTERACTING PROTEIN WITH FHA DOMAIN-CONTAINING PROTEIN A	UniProtKB/Swiss-Prot
Pfam	FHA	UniProtKB/Swiss-Prot
PharmGKB	PA162405777	PharmGKB
PROSITE	FHA_DOMAIN	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49879	UniProtKB/Swiss-Prot
UniProt	I6L962_HUMAN	UniProtKB/TrEMBL
	Q96CG3	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-02	TIFA	TRAF interacting protein with forkhead associated domain		TRAF-interacting protein with forkhead-associated domain	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar