Advanced Search (OLGA)

Gene: CCL3L3 (C-C motif chemokine ligand 3 like 3) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

CCL3L3

Name:

C-C motif chemokine ligand 3 like 3

RGD ID:

1605181

HGNC Page

HGNC:30554

Description:

Predicted to enable CCR chemokine receptor binding activity and chemokine activity. Predicted to be involved in several processes, including antimicrobial humoral immune response mediated by antimicrobial peptide; cell chemotaxis; and chemokine-mediated signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

464.2; C-C motif chemokine 3-like 1; CCL3L1; chemokine (C-C motif) ligand 3-like 3; chemokine (C-C motif) ligand 3-like, centromeric; D17S1718; G0/G1 switch regulatory protein 19-2; G0S19-2; LD78; LD78-beta(1-70); LD78BETA; MGC12815; PAT 464.2; SCYA3L; SCYA3L1; small inducible cytokine A3-like 1; small-inducible cytokine A3-like 1; tonsillar lymphocyte LD78 beta protein

RGD Orthologs

Bonobo

Dog

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	36,194,869 - 36,196,758 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	36,194,869 - 36,196,758 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	34,522,268 - 34,524,157 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	31,546,375 - 31,548,255 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Cytogenetic Map	17	q12	NCBI
CHM1_1	17	34,586,440 - 34,588,319 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	37,142,758 - 37,144,647 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CCL3L3	Human	autistic disorder		IAGP	RGD:14351785	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106\|PMID:30208311
CCL3L3	Human	chromosome 17q12 deletion syndrome		IAGP	RGD:10407793	8554872	ClinVar Annotator: match by term: Chromosome 17q12 deletion syndrome	ClinVar	PMID:24088041\|PMID:26633545

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CCL3L3	Human	Arsenic Poisoning		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16835338
CCL3L3	Human	skin disease		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16835338

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CCL3L3	Human	15-acetyldeoxynivalenol	increases expression	EXP		6480464	15-acetyldeoxynivalenol results in increased expression of CCL3L3 mRNA	CTD	PMID:23792671
CCL3L3	Human	17beta-estradiol	multiple interactions	EXP		6480464	[Estradiol binds to ESR2 protein] which results in decreased expression of CCL3L3 mRNA	CTD	PMID:20404318
CCL3L3	Human	aflatoxin B1	decreases methylation	EXP		6480464	Aflatoxin B1 results in decreased methylation of CCL3L3 gene	CTD	PMID:27153756
CCL3L3	Human	arsane	decreases expression	EXP		6480464	Arsenic results in decreased expression of CCL3L3 mRNA	CTD	PMID:16835338
CCL3L3	Human	arsenic atom	decreases expression	EXP		6480464	Arsenic results in decreased expression of CCL3L3 mRNA	CTD	PMID:16835338
CCL3L3	Human	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of CCL3L3 mRNA	CTD	PMID:30453624
CCL3L3	Human	beta-naphthoflavone	decreases expression	EXP		6480464	beta-Naphthoflavone results in decreased expression of CCL3L3 mRNA	CTD	PMID:32858204
CCL3L3	Human	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of CCL3L3 mRNA	CTD	PMID:29803840
CCL3L3	Human	lipopolysaccharide	increases expression	EXP		6480464	Lipopolysaccharides results in increased expression of CCL3L3 mRNA	CTD	PMID:35811015
CCL3L3	Human	lipopolysaccharide	multiple interactions	EXP		6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CCL3L3 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
CCL3L3	Human	malathion	increases expression	EXP		6480464	Malathion results in increased expression of CCL3L3 mRNA	CTD	PMID:37047231
CCL3L3	Human	pioglitazone	decreases expression	EXP		6480464	Pioglitazone results in decreased expression of CCL3L3 mRNA	CTD	PMID:30031879
CCL3L3	Human	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	EXP		6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CCL3L3 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
CCL3L3	Human	zinc atom	decreases expression	EXP		6480464	Zinc deficiency results in decreased expression of CCL3L3 mRNA	CTD	PMID:22171008
CCL3L3	Human	zinc(0)	decreases expression	EXP		6480464	Zinc deficiency results in decreased expression of CCL3L3 mRNA	CTD	PMID:22171008
CCL3L3	Human	zoledronic acid	increases expression	EXP		6480464	zoledronic acid results in increased expression of CCL3L3 mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CCL3L3	Human	antimicrobial humoral immune response mediated by antimicrobial peptide	involved_in	IBA	PANTHER:PTN000245709\|UniProtKB:O00585\|UniProtKB:O00626\|UniProtKB:O15444\|UniProtKB:P22362\|UniProtKB:P47992\|UniProtKB:P51671\|UniProtKB:P55774\|UniProtKB:P80075\|UniProtKB:Q99616\|UniProtKB:Q99731	150520179		GO_Central	GO_REF:0000033
CCL3L3	Human	cell chemotaxis	involved_in	IEA	GO:0008009	150520179		GOC	GO_REF:0000108
CCL3L3	Human	cell chemotaxis	involved_in	IBA	MGI:104593\|MGI:108224\|MGI:1097153\|MGI:1346316\|MGI:1349183\|MGI:98260\|PANTHER:PTN000245709\|RGD:1303200\|RGD:3644\|RGD:3645\|RGD:3647\|RGD:620441\|RGD:69069\|UniProtKB:O00175\|UniProtKB:O00585\|UniProtKB:O15444\|UniProtKB:P10147\|UniProtKB:P13500\|UniProtKB:P13501\|UniProtKB:P47992\|UniProtKB:P51671\|UniProtKB:P78423\|UniProtKB:P80098\|UniProtKB:Q99616\|UniProtKB:Q99731\|UniProtKB:Q9Y258	150520179		GO_Central	GO_REF:0000033
CCL3L3	Human	chemokine-mediated signaling pathway	involved_in	IBA	MGI:1349183\|PANTHER:PTN000245709\|RGD:3645\|RGD:620458\|UniProtKB:P13501\|UniProtKB:P78423\|UniProtKB:Q9Y258	150520179		GO_Central	GO_REF:0000033
CCL3L3	Human	chemotaxis	involved_in	IEA	UniProtKB-KW:KW-0145	150520179		UniProt	GO_REF:0000043
CCL3L3	Human	immune response	involved_in	IEA	InterPro:IPR000827\|InterPro:IPR001811\|InterPro:IPR036048	150520179		InterPro	GO_REF:0000002
CCL3L3	Human	inflammatory response	involved_in	IBA	MGI:108224\|MGI:98262\|PANTHER:PTN000245709\|RGD:3644\|RGD:3645\|RGD:620458\|RGD:69069\|UniProtKB:P10147\|UniProtKB:P78423	150520179		GO_Central	GO_REF:0000033
CCL3L3	Human	inflammatory response	involved_in	TAS		150520179	PMID:1694014	UniProt	PMID:1694014
CCL3L3	Human	negative regulation of cell population proliferation	involved_in	TAS		150520179	PMID:2271120	UniProt	PMID:2271120
CCL3L3	Human	positive regulation of cell migration	involved_in	IBA	MGI:104593\|MGI:1349183\|MGI:1928953\|MGI:98259\|MGI:98262\|PANTHER:PTN000245709\|RGD:1309255\|RGD:3645\|RGD:620458\|RGD:69069\|UniProtKB:O00175\|UniProtKB:O00585\|UniProtKB:P10147\|UniProtKB:P13236\|UniProtKB:P13501\|UniProtKB:P22362\|UniProtKB:P47992\|UniProtKB:P51671\|UniProtKB:P78423\|UniProtKB:P80098\|UniProtKB:Q99731\|UniProtKB:Q9Y258	150520179		GO_Central	GO_REF:0000033
CCL3L3	Human	signal transduction	involved_in	IEA	GO:0005125	150520179		GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CCL3L3	Human	extracellular region	located_in	IEA	InterPro:IPR000827\|InterPro:IPR001811\|InterPro:IPR036048	150520179		InterPro	GO_REF:0000002
CCL3L3	Human	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
CCL3L3	Human	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
CCL3L3	Human	extracellular region	located_in	TAS		150520179		Reactome	Reactome:R-HSA-443986\|Reactome:R-HSA-6784160
CCL3L3	Human	extracellular space	located_in	IEA	UniProtKB-KW:KW-0202	150520179		UniProt	GO_REF:0000043
CCL3L3	Human	extracellular space	is_active_in	IBA	MGI:101878\|MGI:104593\|MGI:1306779\|MGI:98259\|MGI:98260\|MGI:98261\|MGI:98262\|MGI:99512\|PANTHER:PTN000245709\|RGD:3644\|RGD:3645\|RGD:69069\|UniProtKB:P10147\|UniProtKB:P22362\|UniProtKB:Q9Y258	150520179		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CCL3L3	Human	CCR chemokine receptor binding	enables	IBA	MGI:108224\|MGI:1346316\|MGI:1349183\|MGI:98259\|MGI:98262\|MGI:99512\|PANTHER:PTN000245709\|UniProtKB:O00175\|UniProtKB:O15444\|UniProtKB:P10147\|UniProtKB:P13236\|UniProtKB:P13501\|UniProtKB:P51671\|UniProtKB:P55773\|UniProtKB:P80098\|UniProtKB:Q99731\|UniProtKB:Q9Y258	150520179		GO_Central	GO_REF:0000033
CCL3L3	Human	chemokine activity	enables	IEA	InterPro:IPR000827\|InterPro:IPR001811\|InterPro:IPR036048\|InterPro:IPR039809	150520179		InterPro	GO_REF:0000002
CCL3L3	Human	chemokine activity	enables	IBA	MGI:104593\|MGI:1097153\|MGI:1099448\|MGI:1346316\|MGI:1349183\|MGI:98260\|PANTHER:PTN000245709\|RGD:1303200\|RGD:3644\|RGD:3645\|RGD:3647\|RGD:620441\|RGD:620458\|RGD:69069\|UniProtKB:O00175\|UniProtKB:O00585\|UniProtKB:O15444\|UniProtKB:P10147\|UniProtKB:P13501\|UniProtKB:P22362\|UniProtKB:P47992\|UniProtKB:P51671\|UniProtKB:P55773\|UniProtKB:P78423\|UniProtKB:P80098\|UniProtKB:Q99616\|UniProtKB:Q99731\|UniProtKB:Q9Y258	150520179		GO_Central	GO_REF:0000033
CCL3L3	Human	cytokine activity	enables	IEA	UniProtKB-KW:KW-0202	150520179		UniProt	GO_REF:0000043
CCL3L3	Human	protein binding	enables	IPI	UniProtKB:Q7Z7N9\|UniProtKB:Q96EQ0\|UniProtKB:Q96GZ6\|UniProtKB:Q99735	150520179	PMID:32296183	IntAct	PMID:32296183

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CCL3L3	Human	Chagas disease pathway		IEA		6907045		KEGG	hsa:05142
CCL3L3	Human	rheumatoid arthritis pathway		IEA		6907045		KEGG	hsa:05323

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CCL3L3	Human	Autism		IAGP	RGD:14351785	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106\|PMID:30208311

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1296815	PMID:1694014	PMID:1972563	PMID:2271120	PMID:7566098	PMID:8661057	PMID:8889548	PMID:10364178	PMID:11734558	PMID:12355456	PMID:12477932	PMID:15028295
PMID:15067078	PMID:15728180	PMID:20233400	PMID:21873635	PMID:26116899	PMID:32296183

CCL3L3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	36,194,869 - 36,196,758 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	36,194,869 - 36,196,758 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	34,522,268 - 34,524,157 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	31,546,375 - 31,548,255 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Cytogenetic Map	17	q12	NCBI
CHM1_1	17	34,586,440 - 34,588,319 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	37,142,758 - 37,144,647 (-)	NCBI		T2T-CHM13v2.0

LOC100992309
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	28,386,628 - 28,388,543 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	30,265,580 - 30,267,476 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	20,704,738 - 20,706,641 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	21,000,709 - 21,002,610 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	21,000,709 - 21,002,610 (+)	Ensembl	panpan1.1		panPan2

CCL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	37,693,711 - 37,695,137 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	37,686,480 - 37,695,573 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	36,917,447 - 36,918,873 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	38,504,024 - 38,505,450 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	38,496,812 - 38,505,886 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	37,285,610 - 37,287,036 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	37,572,807 - 37,574,233 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	37,660,062 - 37,661,488 (+)	NCBI		UU_Cfam_GSD_1.0

Variants in CCL3L3
2 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh37/hg19 17q12(chr17:34508117-36248918)x3	copy number gain	See cases [RCV000050286]	Chr17:34508117..36248918 [GRCh37] Chr17:31474518..33323031 [NCBI36] Chr17:17q12	pathogenic\|conflicting data from submitters
GRCh37/hg19 17q12(chr17:34450405-36248918)x1	copy number loss	See cases [RCV000133661]	Chr17:34450405..36248918 [GRCh37] Chr17:31474518..33323031 [NCBI36] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34508117-36248918)x3	copy number gain	See cases [RCV000148166]	Chr17:34508117..36248918 [GRCh37] Chr17:31474518..33323031 [NCBI36] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34437505-34611377)x1	copy number loss	See cases [RCV000136416]	Chr17:34437505..34611377 [GRCh37] Chr17:31461618..31635490 [NCBI36] Chr17:17q12	benign
GRCh37/hg19 17q12(chr17:34508117-34611388)x3	copy number gain	See cases [RCV000136160]	Chr17:34508117..34611388 [GRCh37] Chr17:31474548..31635501 [NCBI36] Chr17:17q12	benign
GRCh38/hg38 17q12(chr17:36104374-36421711)x3	copy number gain	See cases [RCV000138455]	Chr17:36104374..36421711 [GRCh38] Chr17:34431767..34790268 [GRCh37] Chr17:31455880..31864381 [NCBI36] Chr17:17q12	likely benign
GRCh37/hg19 17q12(chr17:34508117-34611396)x3	copy number gain	See cases [RCV000139061]	Chr17:34508117..34611396 [GRCh37] Chr17:31492544..31635509 [NCBI36] Chr17:17q12	likely benign
GRCh37/hg19 17q12(chr17:34431767-34611396)x3	copy number gain	See cases [RCV000139098]	Chr17:34431767..34611396 [GRCh37] Chr17:31455880..31635509 [NCBI36] Chr17:17q12	likely benign
GRCh37/hg19 17q12(chr17:34360168-36248859)x1	copy number loss	See cases [RCV000140228]	Chr17:34360168..36248859 [GRCh37] Chr17:31384281..33322972 [NCBI36] Chr17:17q12	pathogenic
GRCh38/hg38 17q12(chr17:36167804-36421711)x3	copy number gain	See cases [RCV000139489]	Chr17:36167804..36421711 [GRCh38] Chr17:34508117..34790268 [GRCh37] Chr17:31519279..31864381 [NCBI36] Chr17:17q12	likely benign
GRCh37/hg19 17q12(chr17:34431767-34775684)x3	copy number gain	See cases [RCV000139674]	Chr17:34431767..34775684 [GRCh37] Chr17:31455880..31849797 [NCBI36] Chr17:17q12	likely benign
GRCh37/hg19 17q12(chr17:34437482-36244358)x3	copy number gain	See cases [RCV000141832]	Chr17:34437482..36244358 [GRCh37] Chr17:31461595..33318471 [NCBI36] Chr17:17q12	likely pathogenic
NC_000017.10:g.(34360227_34437475)_(36214026_36473024)del	deletion	Chromosome 17q12 deletion syndrome [RCV000191150]	Chr17:34437475..36214026 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34508117-36173763)x1	copy number loss	See cases [RCV000054375]	Chr17:34508117..36173763 [GRCh37] Chr17:31474518..33247876 [NCBI36] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34310998-36297053)x3	copy number gain	See cases [RCV000051912]	Chr17:34310998..36297053 [GRCh37] Chr17:31335111..33373530 [NCBI36] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34360168-36209228)x3	copy number gain	See cases [RCV000051914]	Chr17:34360168..36209228 [GRCh37] Chr17:31384281..33283341 [NCBI36] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34425362-36410559)x3	copy number gain	See cases [RCV000447719]	Chr17:34425362..36410559 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34437482-36404555)x3	copy number gain	See cases [RCV000510217]	Chr17:34437482..36404555 [GRCh37] Chr17:17q12	likely pathogenic
GRCh37/hg19 17q12(chr17:34437482-36350584)x3	copy number gain	See cases [RCV000511415]	Chr17:34437482..36350584 [GRCh37] Chr17:17q12	likely pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:526-81041938)	copy number gain	See cases [RCV000511439]	Chr17:526..81041938 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17q12(chr17:34447113-36283612)x1	copy number loss	See cases [RCV000510761]	Chr17:34447113..36283612 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34475679-36283612)x1	copy number loss	See cases [RCV000510867]	Chr17:34475679..36283612 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:526-81041938)x3	copy number gain	See cases [RCV000512441]	Chr17:526..81041938 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17q12(chr17:34425362-36283612)x3	copy number gain	not provided [RCV000683920]	Chr17:34425362..36283612 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34475679-36311009)x1	copy number loss	not provided [RCV000683922]	Chr17:34475679..36311009 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34477385-36404555)x1	copy number loss	not provided [RCV000683923]	Chr17:34477385..36404555 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34426244-36225988)x3	copy number gain	not provided [RCV000683921]	Chr17:34426244..36225988 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:8547-81060040)x3	copy number gain	not provided [RCV000739324]	Chr17:8547..81060040 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:7214-81058310)x3	copy number gain	not provided [RCV000739320]	Chr17:7214..81058310 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:12344-81057996)x3	copy number gain	not provided [RCV000739325]	Chr17:12344..81057996 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
NC_000017.11:g.(?_36143765)_(37995300_?)del	deletion	Autism [RCV000754203]	Chr17:36143765..37995300 [GRCh38] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34438213-34941924)x3	copy number gain	not provided [RCV000752018]	Chr17:34438213..34941924 [GRCh37] Chr17:17q12	benign
GRCh37/hg19 17q12(chr17:34443811-34819191)x3	copy number gain	not provided [RCV000752019]	Chr17:34443811..34819191 [GRCh37] Chr17:17q12	benign
GRCh37/hg19 17q12(chr17:34443811-34823170)x3	copy number gain	not provided [RCV000752020]	Chr17:34443811..34823170 [GRCh37] Chr17:17q12	benign
GRCh37/hg19 17q12(chr17:34443811-34917969)x4	copy number gain	not provided [RCV000752021]	Chr17:34443811..34917969 [GRCh37] Chr17:17q12	benign
GRCh37/hg19 17q12(chr17:34445325-34917969)x3	copy number gain	not provided [RCV000752022]	Chr17:34445325..34917969 [GRCh37] Chr17:17q12	benign
GRCh37/hg19 17q12(chr17:34437475-36214026)	copy number gain	Chromosome 17q12 duplication syndrome [RCV000767740]	Chr17:34437475..36214026 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17p11.2-q21.2(chr17:21690653-38772647)x3	copy number gain	not provided [RCV000846852]	Chr17:21690653..38772647 [GRCh37] Chr17:17p11.2-q21.2	pathogenic
GRCh37/hg19 17q12(chr17:34405241-34823294)x1	copy number loss	not provided [RCV001259893]	Chr17:34405241..34823294 [GRCh37] Chr17:17q12	uncertain significance
GRCh37/hg19 17q12(chr17:34437475-36243028)	copy number gain	Polyhydramnios [RCV001291974]	Chr17:34437475..36243028 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34463923-36410559)	copy number loss	Chromosome 17q12 deletion syndrome [RCV002280707]	Chr17:34463923..36410559 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34425363-36404555)x3	copy number gain	not provided [RCV002472574]	Chr17:34425363..36404555 [GRCh37] Chr17:17q12	pathogenic
NM_001001437.4(CCL3L3):c.206G>A (p.Arg69Lys)	single nucleotide variant	not specified [RCV004170559]	Chr17:36195362 [GRCh38] Chr17:34522761 [GRCh37] Chr17:17q12	likely benign
GRCh38/hg38 17q12(chr17:36138501-37924067)	copy number gain	Anomalous pulmonary venous return [RCV003223580]	Chr17:36138501..37924067 [GRCh38] Chr17:17q12	pathogenic
GRCh37/hg19 17q11.2-12(chr17:30572862-35843988)	copy number loss	Chromosome 17q12 deletion syndrome [RCV003319594]	Chr17:30572862..35843988 [GRCh37] Chr17:17q11.2-12	pathogenic
GRCh37/hg19 17q12(chr17:34440083-36410559)x3	copy number gain	not provided [RCV003485154]	Chr17:34440083..36410559 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12(chr17:34425362-36371146)x3	copy number gain	not specified [RCV003987227]	Chr17:34425362..36371146 [GRCh37] Chr17:17q12	pathogenic
GRCh37/hg19 17q12-22(chr17:41196270-41277589)	copy number loss	Breast-ovarian cancer, familial, susceptibility to, 1 [RCV004759419]	Chr17:41196270..41277589 [GRCh37] Chr17:17q12-22	pathogenic
NM_001001437.4(CCL3L3):c.212G>A (p.Arg71Gln)	single nucleotide variant	not specified [RCV004895952]	Chr17:36195356 [GRCh38] Chr17:34522755 [GRCh37] Chr17:17q12	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	725
Count of miRNA genes:	489
Interacting mature miRNAs:	543
Transcripts:	ENST00000378354, ENST00000394484, ENST00000588817, ENST00000589736
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298406	BP16_H	Blood pressure QTL 16 (human)		0.0004	Blood pressure	hypertension susceptibility	17	14778647	40778647	Human

RH68318

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	17	q12	UniSTS
Cytogenetic Map	17	q21.1	UniSTS
GeneMap99-GB4 RH Map	17	296.36	UniSTS
NCBI RH Map	17	418.9	UniSTS

SGC35233

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	17	q21.1	UniSTS
GeneMap99-GB4 RH Map	17	295.52	UniSTS
Whitehead-RH Map	17	323.3	UniSTS
NCBI RH Map	17	422.8	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
1137	2055	2074	1925	4087	1372	1749	2	411	1700	255	1697	5648	5658	21	3332	526	1393	1258	161


RefSeq Transcripts	NG_023325	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001001437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA380745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC131056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC233699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC243829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI302038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC007783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC063472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC146919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC147008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC147013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BT006783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF128666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000612839

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	36,194,869 - 36,196,747 (-)	Ensembl

Ensembl Acc Id:

ENST00000616702

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	36,194,996 - 36,196,457 (-)	Ensembl

Ensembl Acc Id:

ENST00000619989 ⟹ ENSP00000480558

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	36,194,869 - 36,196,758 (-)	Ensembl

RefSeq Acc Id:

NM_001001437 ⟹ NP_001001437

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	36,194,869 - 36,196,758 (-)	NCBI
GRCh37	17	34,522,268 - 34,524,147 (-)	ENTREZGENE
Build 36	17	31,546,375 - 31,548,255 (-)	NCBI Archive
CHM1_1	17	34,586,440 - 34,588,319 (-)	NCBI
T2T-CHM13v2.0	17	37,142,758 - 37,144,647 (-)	NCBI

Sequence:

show sequence

AGAAGGACGCAGGCAGCAAAGAGTAGTCAGTCCCTTCTTGGCTCTGCTGACACTCGAGCCCACATTCCATCACCTGCTCCCAATCATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCA
TGGCTCTCTGCAACCAGGTCCTCTCTGCACCACTTGCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTGAGACGAGCAGCCAG
TGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGAGGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCCTGAGGGGTCCAGAAGCTTCG
AGGCCCAGCGACCTCAGTGGGCCCAGTGGGGAGGAGCAGGAGCCTGAGCCTTGGGAACATGCGTGTGACCTCCACAGCTACCTCTTCTATGGACTGGTTATTGCCAAACAGCCACACTGTGGGACTCT
TCTTAACTTAAATTTTAATTTATTTATACTATTTAGTTTTTATAATTTATTTTTGATTTCACAGTGTGTTTGTGATTGTTTGCTCTGAGAGTTCCCCCTGTCCCCTCCACCTTCCCTCACAGTGTGTC
TGGTGACAACCGAGTGGCTGTCATCGGCCTGTGTAGGCAGTCATGGCACCAAAGCCACCAGACTGACAAATGTGTATCAGATGCTTTTGTTCAGGGCTGTGATCGGCCTGGGGAAATAATAAAGATGT
TCTTTTAAACGGTAAA

hide sequence


Protein RefSeqs	NP_001001437	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH07783	(Get FASTA)	NCBI Sequence Viewer
	AAI46920	(Get FASTA)	NCBI Sequence Viewer
	AAI47009	(Get FASTA)	NCBI Sequence Viewer
	AAI47014	(Get FASTA)	NCBI Sequence Viewer
	AAP35429	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000480051.1
	ENSP00000480558
	ENSP00000480558.1
	ENSP00000482487.1
	ENSP00000484704.1
GenBank Protein	P16619	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001001437 ⟸ NM_001001437
- Peptide Label:	precursor
- UniProtKB:	Q53YA5 (UniProtKB/Swiss-Prot), Q3B7A8 (UniProtKB/Swiss-Prot), B2RUX4 (UniProtKB/Swiss-Prot), A6NGK6 (UniProtKB/Swiss-Prot), Q96I68 (UniProtKB/Swiss-Prot), P16619 (UniProtKB/Swiss-Prot), Q14745 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA hide sequence

Ensembl Acc Id:

ENSP00000480558 ⟸ ENST00000619989

Protein Domains

Chemokine interleukin-8-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P16619-F1-model_v2	AlphaFold	P16619	1-93	view protein structure

RGD ID:

7234715

Promoter ID:

EPDNEW_H23102

Type:

multiple initiation site

Name:

CCL3L3_1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	36,196,758 - 36,196,818	EPDNEW

Database	Acc Id	Source(s)
COSMIC	CCL3L3	COSMIC
Ensembl Genes	ENSG00000276085	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSG00000277336	UniProtKB/Swiss-Prot
	ENSG00000277768	UniProtKB/Swiss-Prot
	ENSG00000293545	UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000612067.2	UniProtKB/Swiss-Prot
	ENST00000615140.2	UniProtKB/Swiss-Prot
	ENST00000619989	ENTREZGENE
	ENST00000619989.1	UniProtKB/Swiss-Prot
	ENST00000621940.2	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.50.40	UniProtKB/Swiss-Prot
GTEx	ENSG00000276085	GTEx
	ENSG00000277336	GTEx
	ENSG00000277768	GTEx
	ENSG00000293545	GTEx
HGNC ID	HGNC:30554	ENTREZGENE
Human Proteome Map	CCL3L3	Human Proteome Map
InterPro	Chemokine_b/g/d	UniProtKB/Swiss-Prot
	Chemokine_CC_CS	UniProtKB/Swiss-Prot
	Chemokine_IL8-like_dom	UniProtKB/Swiss-Prot
	Interleukin_8-like_sf	UniProtKB/Swiss-Prot
KEGG Report	hsa:414062	UniProtKB/Swiss-Prot
	hsa:6349	UniProtKB/Swiss-Prot
NCBI Gene	414062	ENTREZGENE
OMIM	609468	OMIM
PANTHER	C-C MOTIF CHEMOKINE 3-LIKE 1	UniProtKB/Swiss-Prot
	PTHR12015	UniProtKB/Swiss-Prot
Pfam	IL8	UniProtKB/Swiss-Prot
PharmGKB	PA142672174	PharmGKB
PROSITE	SMALL_CYTOKINES_CC	UniProtKB/Swiss-Prot
SMART	SCY	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54117	UniProtKB/Swiss-Prot
UniProt	A6NGK6	ENTREZGENE
	B2RUX4	ENTREZGENE
	CL3L1_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q14745	ENTREZGENE, UniProtKB/TrEMBL
	Q3B7A8	ENTREZGENE
	Q53YA5	ENTREZGENE
	Q96I68	ENTREZGENE
UniProt Secondary	A6NGK6	UniProtKB/Swiss-Prot
	B2RUX4	UniProtKB/Swiss-Prot
	Q3B7A8	UniProtKB/Swiss-Prot
	Q53YA5	UniProtKB/Swiss-Prot
	Q96I68	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-07	CCL3L3	C-C motif chemokine ligand 3 like 3		chemokine (C-C motif) ligand 3-like 3	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Human Phenotype Annotations - ClinVar