Symbol:
Gstz1
Name:
glutathione S-transferase zeta 1
RGD ID:
1589363
Description:
Predicted to enable glutathione transferase activity; maleylacetoacetate isomerase activity; and protein homodimerization activity. Involved in cellular detoxification. Is active in cytosol and mitochondrial matrix. Orthologous to human GSTZ1 (glutathione S-transferase zeta 1); PARTICIPATES IN alkaptonuria pathway; disulfiram pharmacodynamics pathway; dopamine beta-hydroxylase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glutathione S-transferase alpha 3; glutathione transferase zeta 1; GSTZ1-1; LOC681913; MAAI; maleylacetoacetate isomerase; similar to Maleylacetoacetate isomerase (MAAI) (Glutathione S-transferase zeta 1) (GSTZ1-1)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 112,525,576 - 112,536,228 (+) NCBI GRCr8 mRatBN7.2 6 106,794,594 - 106,805,284 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 106,794,074 - 106,805,284 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 106,962,390 - 106,973,018 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 107,261,228 - 107,271,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 106,630,899 - 106,641,529 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 111,176,798 - 111,187,246 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 111,176,798 - 111,187,244 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 120,460,963 - 120,471,411 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 6 104,615,943 - 104,626,563 (+) NCBI Celera Cytogenetic Map 6 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gstz1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GSTZ1 mRNA] CTD PMID:31150632 Gstz1 Rat (1->4)-beta-D-glucan multiple interactions ISO Gstz1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GSTZ1 mRNA CTD PMID:36331819 Gstz1 Rat (S)-naringenin increases expression ISO GSTZ1 (Homo sapiens) 6480464 naringenin results in increased expression of GSTZ1 mRNA CTD PMID:24561720 Gstz1 Rat (S)-naringenin multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 Paraquat inhibits the reaction [naringenin results in increased expression of GSTZ1 mRNA] CTD PMID:24561720 Gstz1 Rat 1,1-dichloroethene decreases expression ISO Gstz1 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of GSTZ1 mRNA CTD PMID:26682919 Gstz1 Rat 1-chloro-2,4-dinitrobenzene affects metabolic processing ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein affects the metabolism of Dinitrochlorobenzene CTD PMID:1846734 Gstz1 Rat 17alpha-ethynylestradiol multiple interactions ISO Gstz1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GSTZ1 mRNA CTD PMID:17942748 Gstz1 Rat 17beta-estradiol decreases expression ISO Gstz1 (Mus musculus) 6480464 Estradiol results in decreased expression of GSTZ1 mRNA CTD PMID:39298647 Gstz1 Rat 17beta-estradiol decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Estradiol results in decreased expression of GSTZ1 mRNA CTD PMID:31614463 Gstz1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Gstz1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Gstz1 Rat 2,3,7,8-tetrabromodibenzodioxine increases expression ISO Gstz1 (Mus musculus) 6480464 2 more ... CTD PMID:27604104 Gstz1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gstz1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GSTZ1 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to GSTZ1 promoter] CTD PMID:17942748 and PMID:19654925 Gstz1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GSTZ1 mRNA CTD PMID:32109520 Gstz1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gstz1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSTZ1 mRNA CTD PMID:18163543 Gstz1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gstz1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GSTZ1 mRNA CTD PMID:21570461 Gstz1 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Gstz1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Gstz1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Gstz1 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Gstz1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of GSTZ1 mRNA CTD PMID:18648102 Gstz1 Rat 4,4'-sulfonyldiphenol increases expression ISO Gstz1 (Mus musculus) 6480464 bisphenol S results in increased expression of GSTZ1 mRNA CTD PMID:39298647 Gstz1 Rat 8'-apo-beta,psi-caroten-8'-al decreases expression ISO GSTZ1 (Homo sapiens) 6480464 apocarotenal results in decreased expression of GSTZ1 mRNA CTD PMID:17034753 Gstz1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of GSTZ1 mRNA CTD PMID:31881176 Gstz1 Rat acrylamide decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of GSTZ1 mRNA CTD PMID:32763439 Gstz1 Rat aflatoxin B1 affects expression ISO GSTZ1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of GSTZ1 protein CTD PMID:20106945 Gstz1 Rat aflatoxin B1 decreases expression ISO Gstz1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of GSTZ1 mRNA CTD PMID:19770486 Gstz1 Rat aflatoxin B1 decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of GSTZ1 mRNA CTD PMID:22100608 Gstz1 Rat amiodarone increases expression ISO GSTZ1 (Homo sapiens) 6480464 Amiodarone results in increased expression of GSTZ1 mRNA CTD PMID:19774075 Gstz1 Rat antirheumatic drug decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of GSTZ1 mRNA CTD PMID:24449571 Gstz1 Rat arsenite(3-) multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to GSTZ1 mRNA] CTD PMID:32406909 Gstz1 Rat arsenous acid multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to GSTZ1 protein] CTD PMID:26598702 Gstz1 Rat arsenous acid increases expression ISO GSTZ1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GSTZ1 mRNA CTD PMID:15761015 Gstz1 Rat artesunate affects response to substance ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 mRNA affects the susceptibility to artesunate CTD PMID:15796179 Gstz1 Rat benzo[a]pyrene decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GSTZ1 mRNA CTD PMID:20106945 Gstz1 Rat benzo[a]pyrene decreases expression ISO Gstz1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GSTZ1 mRNA CTD PMID:19770486 Gstz1 Rat beta-carotene decreases expression ISO GSTZ1 (Homo sapiens) 6480464 beta Carotene results in decreased expression of GSTZ1 mRNA CTD PMID:17034753 Gstz1 Rat beta-lapachone increases expression ISO GSTZ1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of GSTZ1 mRNA CTD PMID:38218311 Gstz1 Rat beta-lapachone decreases expression ISO GSTZ1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of GSTZ1 mRNA CTD PMID:38218311 Gstz1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GSTZ1 mRNA CTD PMID:25181051 Gstz1 Rat bisphenol AF increases expression ISO GSTZ1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of GSTZ1 protein CTD PMID:34186270 Gstz1 Rat Bisphenol B increases expression ISO GSTZ1 (Homo sapiens) 6480464 bisphenol B results in increased expression of GSTZ1 protein CTD PMID:34186270 Gstz1 Rat bisphenol F increases expression ISO GSTZ1 (Homo sapiens) 6480464 bisphenol F results in increased expression of GSTZ1 protein CTD PMID:34186270 Gstz1 Rat cadmium dichloride decreases expression ISO Gstz1 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of GSTZ1 mRNA CTD PMID:20061341 Gstz1 Rat cadmium dichloride increases expression ISO GSTZ1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GSTZ1 protein CTD PMID:24527689 Gstz1 Rat cadmium sulfide increases expression ISO GSTZ1 (Homo sapiens) 6480464 cadmium sulfide results in increased expression of GSTZ1 mRNA CTD PMID:27866839 Gstz1 Rat carbamazepine affects expression ISO GSTZ1 (Homo sapiens) 6480464 Carbamazepine affects the expression of GSTZ1 mRNA CTD PMID:25979313 Gstz1 Rat carbamazepine increases expression ISO GSTZ1 (Homo sapiens) 6480464 Carbamazepine results in increased expression of GSTZ1 mRNA CTD PMID:17112801 Gstz1 Rat carbon nanotube decreases expression ISO Gstz1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Gstz1 Rat cerium trichloride multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 [cerous chloride co-treated with lanthanum chloride] results in increased expression of GSTZ1 mRNA CTD PMID:28954213 Gstz1 Rat chlorpyrifos decreases expression ISO Gstz1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of GSTZ1 mRNA CTD PMID:37019170 Gstz1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of GSTZ1 protein CTD PMID:22023808 Gstz1 Rat clofibrate increases expression ISO Gstz1 (Mus musculus) 6480464 Clofibrate results in increased expression of GSTZ1 mRNA CTD PMID:18723825 Gstz1 Rat cobalt dichloride decreases expression ISO GSTZ1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of GSTZ1 mRNA CTD PMID:19376846 Gstz1 Rat crocidolite asbestos decreases expression ISO Gstz1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of GSTZ1 mRNA CTD PMID:29279043 Gstz1 Rat cumene hydroperoxide affects metabolic processing ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein affects the metabolism of cumene hydroperoxide CTD PMID:9396740 Gstz1 Rat cyclosporin A decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GSTZ1 mRNA CTD PMID:20106945 Gstz1 Rat cyfluthrin decreases expression ISO GSTZ1 (Homo sapiens) 6480464 cyfluthrin results in decreased expression of GSTZ1 mRNA CTD PMID:31330490 Gstz1 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of GSTZ1 mRNA CTD PMID:23640034 Gstz1 Rat decabromodiphenyl ether affects expression ISO GSTZ1 (Homo sapiens) 6480464 decabromobiphenyl ether affects the expression of GSTZ1 mRNA CTD PMID:24834073 Gstz1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of GSTZ1 mRNA CTD PMID:23640034 Gstz1 Rat diarsenic trioxide multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to GSTZ1 protein] CTD PMID:26598702 Gstz1 Rat diarsenic trioxide increases expression ISO GSTZ1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GSTZ1 mRNA CTD PMID:15761015 Gstz1 Rat Dibutyl phosphate affects expression ISO GSTZ1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GSTZ1 mRNA CTD PMID:37042841 Gstz1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GSTZ1 mRNA CTD PMID:21266533 Gstz1 Rat dibutyl phthalate decreases expression ISO Gstz1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of GSTZ1 mRNA CTD PMID:17361019 and PMID:21266533 Gstz1 Rat dichloroacetic acid multiple interactions EXP 6480464 Dichloroacetic Acid results in decreased expression of and results in decreased activity of GSTZ1 protein and GSTZ1 protein affects the metabolism of and results in increased activity of Dichloroacetic Acid CTD PMID:12019185 more ... Gstz1 Rat dichloroacetic acid decreases activity ISO GSTZ1 (Homo sapiens) 6480464 Dichloroacetic Acid results in decreased activity of GSTZ1 protein and Dichloroacetic Acid results in decreased activity of GSTZ1 protein polymorphism CTD PMID:12119007 more ... Gstz1 Rat dichloroacetic acid affects metabolic processing ISO Gstz1 (Mus musculus) 6480464 GSTZ1 protein affects the metabolism of Dichloroacetic Acid CTD PMID:15277241 Gstz1 Rat dichloroacetic acid increases metabolic processing ISO Gstz1 (Mus musculus) 6480464 GSTZ1 protein results in increased metabolism of Dichloroacetic Acid CTD PMID:20045428 Gstz1 Rat dichloroacetic acid decreases activity ISO Gstz1 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased activity of GSTZ1 protein CTD PMID:11960676 Gstz1 Rat dichloroacetic acid affects metabolic processing EXP 6480464 GSTZ1 protein affects the metabolism of Dichloroacetic Acid CTD PMID:12019185 more ... Gstz1 Rat dichloroacetic acid multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 Bromides inhibits the reaction [Dichloroacetic Acid results in decreased activity of GSTZ1 protein] more ... CTD PMID:12437329 and PMID:24632415 Gstz1 Rat dichloroacetic acid decreases activity EXP 6480464 Dichloroacetic Acid results in decreased activity of GSTZ1 protein CTD PMID:10471397 more ... Gstz1 Rat dichloroacetic acid decreases expression EXP 6480464 Dichloroacetic Acid results in decreased expression of GSTZ1 protein CTD PMID:14599561 Gstz1 Rat dichloroacetic acid increases metabolic processing ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein SNP results in increased metabolism of Dichloroacetic Acid CTD PMID:10739172 Gstz1 Rat dinophysistoxin 1 decreases expression ISO GSTZ1 (Homo sapiens) 6480464 dinophysistoxin 1 results in decreased expression of GSTZ1 mRNA CTD PMID:28939011 Gstz1 Rat dioxygen multiple interactions ISO Gstz1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of GSTZ1 mRNA CTD PMID:30529165 Gstz1 Rat enzyme inhibitor multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of GSTZ1 protein CTD PMID:23301498 Gstz1 Rat etacrynic acid affects metabolic processing ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein affects the metabolism of Ethacrynic Acid CTD PMID:9396740 Gstz1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of GSTZ1 mRNA CTD PMID:24136188 Gstz1 Rat fumonisin B1 decreases expression ISO Gstz1 (Mus musculus) 6480464 fumonisin B1 results in decreased expression of GSTZ1 mRNA CTD PMID:16221962 Gstz1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of GSTZ1 mRNA CTD PMID:24136188 Gstz1 Rat glutathione affects metabolic processing ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein affects the metabolism of Glutathione CTD PMID:1846734 Gstz1 Rat glutathione affects binding ISO GSTZ1 (Homo sapiens) 6480464 Glutathione binds to GSTZ1 protein CTD PMID:11327815 more ... Gstz1 Rat glutathione multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein binds to and affects the metabolism of Glutathione CTD PMID:12852784 Gstz1 Rat hemin decreases activity ISO GSTZ1 (Homo sapiens) 6480464 Hemin results in decreased activity of GSTZ1 protein CTD PMID:1846734 Gstz1 Rat hydrogen peroxide affects metabolic processing ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein affects the metabolism of Hydrogen Peroxide CTD PMID:1846734 Gstz1 Rat iodide salt multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 Iodides inhibits the reaction [Dichloroacetic Acid results in decreased activity of GSTZ1 protein] CTD PMID:24632415 Gstz1 Rat isoflavones affects expression ISO GSTZ1 (Homo sapiens) 6480464 Isoflavones affects the expression of GSTZ1 mRNA CTD PMID:16365062 Gstz1 Rat isotretinoin decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of GSTZ1 mRNA CTD PMID:20436886 Gstz1 Rat ivermectin decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GSTZ1 protein CTD PMID:32959892 Gstz1 Rat lanthanum trichloride multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 [cerous chloride co-treated with lanthanum chloride] results in increased expression of GSTZ1 mRNA CTD PMID:28954213 Gstz1 Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of GSTZ1 protein CTD PMID:36539177 Gstz1 Rat methylmercury chloride decreases expression ISO GSTZ1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of GSTZ1 mRNA CTD PMID:28001369 Gstz1 Rat methylmercury chloride increases expression ISO GSTZ1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of GSTZ1 mRNA CTD PMID:29581082 Gstz1 Rat microcystin decreases expression EXP 6480464 Microcystins results in decreased expression of GSTZ1 mRNA CTD PMID:19790251 Gstz1 Rat microcystin affects expression EXP 6480464 Microcystins affects the expression of GSTZ1 mRNA CTD PMID:19790251 Gstz1 Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of GSTZ1 mRNA CTD PMID:34740672 Gstz1 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of GSTZ1 protein CTD PMID:19716841 Gstz1 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of GSTZ1 mRNA CTD PMID:24136188 Gstz1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of GSTZ1 mRNA CTD PMID:33484710 Gstz1 Rat ochratoxin A decreases expression ISO GSTZ1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of GSTZ1 mRNA CTD PMID:32905824 Gstz1 Rat ozone multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of GSTZ1 mRNA CTD PMID:35430440 Gstz1 Rat paracetamol affects expression ISO Gstz1 (Mus musculus) 6480464 Acetaminophen affects the expression of GSTZ1 mRNA CTD PMID:17562736 Gstz1 Rat paracetamol multiple interactions ISO Gstz1 (Mus musculus) 6480464 [CTH gene mutant form results in increased susceptibility to Acetaminophen] which results in decreased expression of GSTZ1 protein CTD PMID:25499718 Gstz1 Rat paracetamol increases expression ISO GSTZ1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of GSTZ1 mRNA CTD PMID:25704631 Gstz1 Rat paracetamol affects response to substance ISO Gstz1 (Mus musculus) 6480464 GSTZ1 protein affects the susceptibility to Acetaminophen CTD PMID:16278372 Gstz1 Rat paraquat increases expression ISO GSTZ1 (Homo sapiens) 6480464 Paraquat results in increased expression of GSTZ1 mRNA CTD PMID:22996356 Gstz1 Rat paraquat multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 [Paraquat co-treated with Quercetin] results in increased expression of GSTZ1 mRNA and Paraquat inhibits the reaction [naringenin results in increased expression of GSTZ1 mRNA] CTD PMID:22996356 and PMID:24561720 Gstz1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gstz1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GSTZ1 mRNA CTD PMID:36331819 Gstz1 Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of GSTZ1 mRNA CTD PMID:31324951 Gstz1 Rat phenobarbital affects expression ISO GSTZ1 (Homo sapiens) 6480464 Phenobarbital affects the expression of GSTZ1 mRNA CTD PMID:19159669 Gstz1 Rat phenobarbital decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Phenobarbital results in decreased expression of GSTZ1 protein CTD PMID:28541575 Gstz1 Rat pirinixic acid multiple interactions ISO Gstz1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of GSTZ1 mRNA CTD PMID:19710929 Gstz1 Rat pirinixic acid increases expression ISO Gstz1 (Mus musculus) 6480464 pirinixic acid results in increased expression of GSTZ1 mRNA CTD PMID:17426115 Gstz1 Rat quercetin multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 [Paraquat co-treated with Quercetin] results in increased expression of GSTZ1 mRNA CTD PMID:22996356 Gstz1 Rat quercetin increases expression ISO GSTZ1 (Homo sapiens) 6480464 Quercetin results in increased expression of GSTZ1 mRNA CTD PMID:22996356 Gstz1 Rat resveratrol increases expression ISO Gstz1 (Mus musculus) 6480464 resveratrol results in increased expression of GSTZ1 mRNA CTD PMID:22610192 Gstz1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of GSTZ1 mRNA CTD PMID:28374803 Gstz1 Rat sarin decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Sarin results in decreased expression of GSTZ1 mRNA CTD PMID:19522546 Gstz1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of GSTZ1 protein CTD PMID:29459688 Gstz1 Rat sodium arsenite increases expression ISO GSTZ1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GSTZ1 mRNA CTD PMID:38568856 Gstz1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of GSTZ1 mRNA CTD PMID:22110744 Gstz1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of GSTZ1 mRNA CTD PMID:25993096 Gstz1 Rat sodium fluoride increases expression ISO Gstz1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of GSTZ1 protein CTD PMID:28918527 Gstz1 Rat stilbene oxide affects metabolic processing ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein affects the metabolism of stilbene oxide CTD PMID:1846734 Gstz1 Rat sulfites multiple interactions ISO GSTZ1 (Homo sapiens) 6480464 Sulfites inhibits the reaction [Dichloroacetic Acid results in decreased activity of GSTZ1 protein] CTD PMID:24632415 Gstz1 Rat sunitinib decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GSTZ1 mRNA CTD PMID:31533062 Gstz1 Rat tert-butyl hydroperoxide affects metabolic processing ISO GSTZ1 (Homo sapiens) 6480464 GSTZ1 protein affects the metabolism of tert-Butylhydroperoxide CTD PMID:9396740 Gstz1 Rat testosterone increases expression ISO GSTZ1 (Homo sapiens) 6480464 Testosterone results in increased expression of GSTZ1 mRNA CTD PMID:33359661 Gstz1 Rat testosterone decreases expression ISO Gstz1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of GSTZ1 mRNA CTD PMID:33848595 Gstz1 Rat tetrachloromethane decreases expression ISO Gstz1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of GSTZ1 mRNA CTD PMID:27339419 and PMID:31919559 Gstz1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GSTZ1 mRNA] CTD PMID:31150632 Gstz1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GSTZ1 mRNA CTD PMID:31150632 Gstz1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GSTZ1 mRNA CTD PMID:23411599 and PMID:34492290 Gstz1 Rat titanium dioxide decreases expression ISO Gstz1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of GSTZ1 mRNA CTD PMID:23557971 Gstz1 Rat titanium dioxide decreases methylation ISO Gstz1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GSTZ1 promoter CTD PMID:35295148 Gstz1 Rat valproic acid decreases expression ISO GSTZ1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GSTZ1 mRNA CTD PMID:23179753 more ... Gstz1 Rat valproic acid affects expression ISO GSTZ1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GSTZ1 mRNA CTD PMID:25979313 Gstz1 Rat vancomycin increases expression ISO Gstz1 (Mus musculus) 6480464 Vancomycin results in increased expression of GSTZ1 mRNA CTD PMID:18930951 Gstz1 Rat XL147 multiple interactions ISO Gstz1 (Mus musculus) 6480464 XL147 inhibits the reaction [N-nitroso-tris-chloroethylurea results in increased expression of GSTZ1 mRNA] CTD PMID:29891994
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
External Pathway Database Links
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) (S)-naringenin (ISO) 1,1-dichloroethene (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrabromodibenzodioxine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 8'-apo-beta,psi-caroten-8'-al (ISO) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) amiodarone (ISO) antirheumatic drug (ISO) arsenite(3-) (ISO) arsenous acid (ISO) artesunate (ISO) benzo[a]pyrene (ISO) beta-carotene (ISO) beta-lapachone (ISO) bisphenol A (EXP) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (ISO) cadmium sulfide (ISO) carbamazepine (ISO) carbon nanotube (ISO) cerium trichloride (ISO) chlorpyrifos (ISO) cisplatin (EXP) clofibrate (ISO) cobalt dichloride (ISO) crocidolite asbestos (ISO) cumene hydroperoxide (ISO) cyclosporin A (ISO) cyfluthrin (ISO) decabromodiphenyl ether (EXP,ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (EXP,ISO) dinophysistoxin 1 (ISO) dioxygen (ISO) enzyme inhibitor (ISO) etacrynic acid (ISO) flutamide (EXP) fumonisin B1 (ISO) glafenine (EXP) glutathione (ISO) hemin (ISO) hydrogen peroxide (ISO) iodide salt (ISO) isoflavones (ISO) isotretinoin (ISO) ivermectin (ISO) lanthanum trichloride (ISO) lead diacetate (EXP) methylmercury chloride (ISO) microcystin (EXP) microcystin-LR (EXP) N-nitrosomorpholine (EXP) nimesulide (EXP) nitrofen (EXP) ochratoxin A (ISO) ozone (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) phenformin (EXP) phenobarbital (ISO) pirinixic acid (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) sarin (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP) sodium fluoride (ISO) stilbene oxide (ISO) sulfites (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) valproic acid (ISO) vancomycin (ISO) XL147 (ISO)
External Pathway Database Links
Gstz1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 112,525,576 - 112,536,228 (+) NCBI GRCr8 mRatBN7.2 6 106,794,594 - 106,805,284 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 106,794,074 - 106,805,284 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 106,962,390 - 106,973,018 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 107,261,228 - 107,271,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 106,630,899 - 106,641,529 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 111,176,798 - 111,187,246 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 111,176,798 - 111,187,244 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 120,460,963 - 120,471,411 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 6 104,615,943 - 104,626,563 (+) NCBI Celera Cytogenetic Map 6 q31 NCBI
GSTZ1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 77,321,036 - 77,331,597 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 77,320,996 - 77,331,597 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 77,787,379 - 77,797,940 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 76,857,107 - 76,867,693 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 76,857,106 - 76,867,692 NCBI Celera 14 57,825,806 - 57,836,516 (+) NCBI Celera Cytogenetic Map 14 q24.3 NCBI HuRef 14 57,953,339 - 57,964,018 (+) NCBI HuRef CHM1_1 14 77,726,689 - 77,737,398 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 71,530,399 - 71,540,959 (+) NCBI T2T-CHM13v2.0
Gstz1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 87,192,102 - 87,211,497 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 87,193,939 - 87,211,497 (+) Ensembl GRCm39 Ensembl GRCm38 12 87,147,161 - 87,164,723 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 87,147,165 - 87,164,723 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 88,488,668 - 88,505,673 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 88,036,821 - 88,053,826 (+) NCBI MGSCv36 mm8 Celera 12 88,612,223 - 88,629,231 (+) NCBI Celera Cytogenetic Map 12 D2 NCBI cM Map 12 41.34 NCBI
Gstz1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 1,219,018 - 1,231,287 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 1,218,990 - 1,231,407 (+) NCBI ChiLan1.0 ChiLan1.0
GSTZ1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 78,404,884 - 78,432,045 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 77,621,388 - 77,648,486 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 57,874,184 - 57,901,397 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 77,075,814 - 77,102,745 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 77,075,814 - 77,086,530 (+) Ensembl panpan1.1 panPan2
GSTZ1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 50,133,496 - 50,143,487 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 50,133,714 - 50,143,439 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 49,821,231 - 49,831,169 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 50,367,085 - 50,377,034 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 50,367,124 - 50,377,028 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 50,029,935 - 50,039,870 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 50,052,790 - 50,063,232 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 50,450,973 - 50,460,913 (+) NCBI UU_Cfam_GSD_1.0
Gstz1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 25,910,957 - 25,927,021 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936488 6,141,317 - 6,154,075 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936488 6,141,913 - 6,153,591 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GSTZ1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 100,392,271 - 100,408,420 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 100,392,217 - 100,404,025 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 106,553,162 - 106,564,936 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GSTZ1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 54,567,594 - 54,578,262 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 54,567,655 - 54,579,613 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 42,767,574 - 42,778,242 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gstz1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 181 Count of miRNA genes: 145 Interacting mature miRNAs: 162 Transcripts: ENSRNOT00000072215 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
RH137359
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 106,805,004 - 106,805,201 (+) MAPPER mRatBN7.2 Rnor_6.0 6 111,186,972 - 111,187,168 NCBI Rnor6.0 Rnor_5.0 6 120,471,137 - 120,471,333 UniSTS Rnor5.0 Celera 6 104,626,291 - 104,626,487 UniSTS RH 3.4 Map 6 748.89 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000072215 ⟹ ENSRNOP00000065390
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 106,794,074 - 106,805,284 (+) Ensembl Rnor_6.0 Ensembl 6 111,176,798 - 111,187,244 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082027 ⟹ ENSRNOP00000073813
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 106,798,160 - 106,804,566 (+) Ensembl Rnor_6.0 Ensembl 6 111,180,108 - 111,186,546 (+) Ensembl
RefSeq Acc Id:
NM_001109445 ⟹ NP_001102915
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 112,525,606 - 112,536,226 (+) NCBI mRatBN7.2 6 106,794,656 - 106,805,277 (+) NCBI Rnor_6.0 6 111,176,798 - 111,187,244 (+) NCBI Rnor_5.0 6 120,460,963 - 120,471,411 (+) NCBI Celera 6 104,615,943 - 104,626,563 (+) RGD
Sequence:
GGGGGCGGGGCCAGCCCGAAGGAGGGAACGCCATCTAGTCCAACCTTCGCTCTCTGGACCCCGCTAGGCCTCAGTCATCTTCTAGTCCTGAGAACTGACTTTCTTGGCTGGCCGACGGGCGAGATGCA AGCCGGGAAGCCTGTTCTCTATTCCTATTTCCGAAGCTCCTGTTCATGGAGAGTTCGAATTGCTCTGGCGTTAAAAGGCATTGACTATGAGATAGTGCCCATCAACCTCATAAAGGATGGCGGGCAAC AGTTCTCCGAGGAATTTCAGACCCTGAATCCCATGAAGCAAGTGCCAGCACTGAAGATTGATGGAATCACCATTGGCCAGTCACTGGCCATCCTGGAGTACCTGGAAGAGACTCGACCCATCCCACGG CTCCTGCCCCAGGACCCACAGAAAAGAGCCATCGTGCGCATGATTTCTGACCTCATCGCCAGTGGCATCCAGCCCCTTCAGAACCTGTCTGTCCTGAAGCAAGTGGGACAGGAGAACCAGATGCCTTG GGCCCAAAAGGCTATTACTTCCGGCTTTAATGCTCTGGAGAAGATCCTGCAAAGCACAGCAGGGAAGTACTGTGTAGGAGATGAGGTGTCCATGGCTGATGTGTGCTTAGCGCCCCAAGTGGCAAATG CTGAAAGGTTCAAGGTGGACCTAAGCCCCTACCCTACCATCAGTCACATCAACAAGGCACTGCTGGCCTTAGAGGCTTTCCAAGTGTCTCACCCCTGTCGACAGCCAGATACACCGGCCGAGCTGAGG ACTTAGCTCCCAAACCATGCCTCACTGGTACAGGGAGGGGAGTAGGGCTCAGATGTTGGGTGTCTTAGGGTTTTACTGCTGTGAAGAGACACCAAGACCATGGCAACTCTAAAAGAGGAAAACATTTA ATTGGGGTGGGCTTACAGTTTCAGAGGTTCAGTCTATTATCATCATGGTGGGAGCATGGTAGCATCCAGGCACACATGGTGTTGGAGAGGTAACTGAGAGTTCACATCTGGATCCGAAGGCAGCAGGA AGAGGGAGTGACACTGGGCCTGGCATGAGCAACCTGAAACCTTAAAGCCGGTTCCCAATGATACTTTTCCTCCAAAAAGGCCACACCTGCTATTAGTGCCACTACCAACGTACCCGATGGGGGTCATT TTTGTTCAAATCCAAGCAGGCCCAGAAATGAATGAATTGTAGTAGAGGATTTGAACTTTAGCTCTTTCCTCAAGAAGCAGCAGATTCGTGGAGTCCATGATATTTCTTCAAGGTCCCCATATTAAGAG TTTTCTCTAGCGAAATGAAGCCAGTAGGATATATCTTCCTCCTGCTTGCACTGTAGCCCCTACATTCTGCCTTCATCCTCTTACCTGTCATGTGTTAGGAGGGGGGAGGCAGAGACATGGCCTGCTCT GCTAATGATAATTGTCAACTTGAAATAAAATTAGAGTCACTAGGGAAAAGGGCCTTTATGAATGTCTGTTGAAGTGGGAAGACTCACCCATCACGGATGGCACCATTCCCTGGGTAGAGGATCCTGGG ACTAGAAGAGTAGAGAAAGAGTGGAGCAACTGCCATGTGTGCATTCTGATTGGTTCTCACGCAGATGCCTTGACTCCCCTGCCATTACCGACTGTAACCTGAGACTATGAGCCAAAATAAACCTCCTC TCCTTT
hide sequence
RefSeq Acc Id:
XM_006240399 ⟹ XP_006240461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 112,528,968 - 112,536,228 (+) NCBI mRatBN7.2 6 106,798,069 - 106,805,284 (+) NCBI Rnor_6.0 6 111,180,209 - 111,187,246 (+) NCBI Rnor_5.0 6 120,460,963 - 120,471,411 (+) NCBI
Sequence:
GCTTTCCCATTGGCTCCTGAGAACCACCCCTTTGGGTTCCGCCCCCTGCCTCACAGTTCTGTTA GGAAAGACAATTCTTAGGAAGCTACTGCACTATGGCTAGCAAGCCTGTTCTCTATTCCTATTTCCGAAGCTCCTGTTCATGGAGAGTTCGAATTGCTCTGGCGTTAAAAGGCATTGACTATGAGATAG TGCCCATCAACCTCATAAAGGATGGCGGGCAACAGTTCTCCGAGGAATTTCAGACCCTGAATCCCATGAAGCAAGTGCCAGCACTGAAGATTGATGGAATCACCATTGGCCAGTCACTGGCCATCCTG GAGTACCTGGAAGAGACTCGACCCATCCCACGGCTCCTGCCCCAGGACCCACAGAAAAGAGCCATCGTGCGCATGATTTCTGACCTCATCGCCAGTGGCATCCAGCCCCTTCAGAACCTGTCTGTCCT GAAGCAAGTGGGACAGGAGAACCAGATGCCTTGGGCCCAAAAGGCTATTACTTCCGGCTTTAATGCTCTGGAGAAGATCCTGCAAAGCACAGCAGGGAAGTACTGTGTAGGAGATGAGGTGTCCATGG CTGATGTGTGCTTAGCGCCCCAAGTGGCAAATGCTGAAAGGTTCAAGGTGGACCTAAGCCCCTACCCTACCATCAGTCACATCAACAAGGCACTGCTGGCCTTAGAGGCTTTCCAAGTGTCTCACCCC TGTCGACAGCCAGATACACCGGCCGAGCTGAGGACTTAGCTCCCAAACCATGCCTCACTGGTACAGGGAGGGGAGTAGGGCTCAGATGTTGGGTGTCTTAGGGTTTTACTGCTGTGAAGAGACACCAA GACCATGGCAACTCTAAAAGAGGAAAACATTTAATTGGGGTGGGCTTACAGTTTCAGAGGTTCAGTCTATTATCATCATGGTGGGAGCATGGTAGCATCCAGGCACACATGGTGTTGGAGAGGTAACT GAGAGTTCACATCTGGATCCGAAGGCAGCAGGAAGAGGGAGTGACACTGGGCCTGGCATGAGCAACCTGAAACCTTAAAGCCGGTTCCCAATGATACTTTTCCTCCAAAAAGGCCACACCTGCTATTA GTGCCACTACCAACGTACCCGATGGGGGTCATTTTTGTTCAAATCCAAGCAGGCCCAGAAATGAATGAATTGTAGTAGAGGATTTGAACTTTAGCTCTTTCCTCAAGAAGCAGCAGATTCGTGGAGTC CATGATATTTCTTCAAGGTCCCCATATTAAGAGTTTTCTCTAGCGAAATGAAGCCAGTAGGATATATCTTCCTCCTGCTTGCACTGTAGCCCCTACATTCTGCCTTCATCCTCTTACCTGTCATGTGT TAGGAGGGGGGAGGCAGAGACATGGCCTGCTCTGCTAATGATAATTGTCAACTTGAAATAAAATTAGAGTCACTAGGGAAAAGGGCCTTTATGAATGTCTGTTGAAGTGGGAAGACTCACCCATCACG GATGGCACCATTCCCTGGGTAGAGGATCCTGGGACTAGAAGAGTAGAGAAAGAGTGGAGCAACTGCCATGTGTGCATTCTGATTGGTTCTCACGCAGATGCCTTGACTCCCCTGCCATTACCGACTGT AACCTGAGACTATGAGCCAAAATAAACCTCCTCTCCTTTAA
hide sequence
RefSeq Acc Id:
XM_039112925 ⟹ XP_038968853
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 112,525,576 - 112,533,586 (+) NCBI mRatBN7.2 6 106,794,594 - 106,802,606 (+) NCBI
RefSeq Acc Id:
XM_063262472 ⟹ XP_063118542
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 112,529,140 - 112,536,228 (+) NCBI
RefSeq Acc Id:
NP_001102915 ⟸ NM_001109445
- UniProtKB:
B0BNI1 (UniProtKB/Swiss-Prot), P57113 (UniProtKB/Swiss-Prot)
- Sequence:
MQAGKPVLYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGITIGQSLAILEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQM PWAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAERFKVDLSPYPTISHINKALLALEAFQVSHPCRQPDTPAELRT
hide sequence
RefSeq Acc Id:
XP_006240461 ⟸ XM_006240399
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K6H2 (UniProtKB/TrEMBL), A6JE83 (UniProtKB/TrEMBL)
- Sequence:
MASKPVLYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGITIGQSLAILEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLKQVGQENQMP WAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVANAERFKVDLSPYPTISHINKALLALEAFQVSHPCRQPDTPAELRT
hide sequence
Ensembl Acc Id:
ENSRNOP00000073813 ⟸ ENSRNOT00000082027
Ensembl Acc Id:
ENSRNOP00000065390 ⟸ ENSRNOT00000072215
RefSeq Acc Id:
XP_038968853 ⟸ XM_039112925
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063118542 ⟸ XM_063262472
- Peptide Label:
isoform X3
- UniProtKB:
A6JE85 (UniProtKB/TrEMBL)
RGD ID: 13694751
Promoter ID: EPDNEW_R5276
Type: multiple initiation site
Name: Gstz1_2
Description: glutathione S-transferase zeta 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R5278
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 111,176,846 - 111,176,906 EPDNEW
RGD ID: 13694753
Promoter ID: EPDNEW_R5278
Type: initiation region
Name: Gstz1_1
Description: glutathione S-transferase zeta 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R5276
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 111,180,288 - 111,180,348 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-16
Gstz1
glutathione S-transferase zeta 1
Gstz1
glutathione transferase zeta 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-12-02
Gstz1
glutathione transferase zeta 1
LOC681913
similar to Maleylacetoacetate isomerase (MAAI) (Glutathione S-transferase zeta 1) (GSTZ1-1)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-11-19
LOC681913
similar to Maleylacetoacetate isomerase (MAAI) (Glutathione S-transferase zeta 1) (GSTZ1-1)
Symbol and Name status set to provisional
70820
PROVISIONAL