Barx2 (BARX homeobox 2) - Rat Genome Database

Name: Barx2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Barx2 (BARX homeobox 2) Rattus norvegicus

Analyze

Symbol:

Barx2

Name:

BARX homeobox 2

RGD ID:

1584840

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II transcription regulatory region sequence-specific DNA binding activity; and chromatin binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including cartilage condensation; regulation of transcription by RNA polymerase II; and skeletal muscle cell differentiation. Predicted to be located in several cellular components, including Golgi apparatus; actin cytoskeleton; and nucleoplasm. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Orthologous to human BARX2 (BARX homeobox 2); INTERACTS WITH indole-3-methanol; N-acetyl-L-cysteine; N-nitrosodiethylamine.

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

BarH-like homeobox 2; BARX homeobox 2, pseudogene 1; Barx2-ps1; homeobox protein BarH-like 2; LOC679701; similar to BarH-like homeobox 2

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BARX2 (BARX homeobox 2)	RGD	RGD
Mus musculus (house mouse):	Barx2 (BarH-like homeobox 2)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Barx2 (BARX homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BARX2 (BARX homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BARX2 (BARX homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Barx2 (BARX homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BARX2 (BARX homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BARX2 (BARX homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Barx2 (BARX homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	BARX2 (BARX homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Barx2 (BarH-like homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	barx2 (BARX homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-30	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	barx2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	30,251,132 - 30,319,105 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	30,251,132 - 30,319,013 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	8	32,950,878 - 33,018,245 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	32,950,875 - 33,017,854 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	32,973,711 - 33,040,595 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	31,572,341 - 31,659,306 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	31,710,513 - 31,778,220 (-)	NCBI		Celera
Cytogenetic Map	8	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chromosome 11, Partial Trisomy 11q (ISO)

Dwarfism (ISO)

genetic disease (ISO)

Jacobsen Syndrome (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

aflatoxin B1 (ISO)

antimonite (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

choline (ISO)

chromium(6+) (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

folic acid (ISO)

fulvestrant (ISO)

indole-3-methanol (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

paracetamol (EXP)

PCB138 (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

testosterone (ISO)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cartilage condensation (ISO)

myotube differentiation (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA)

skeletal muscle cell differentiation (ISO)

transcription by RNA polymerase II (ISO)

Cellular Component

actin cytoskeleton (IEA,ISO)

cytosol (IEA,ISO)

Golgi apparatus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA)

transcription regulator complex (ISO)

Molecular Function

chromatin binding (ISO)

DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA,ISO)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10854790	PMID:11278942	PMID:12486129	PMID:14744868	PMID:15728386	PMID:15800003

Genomics

Comparative Map Data

Barx2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	30,251,132 - 30,319,105 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	30,251,132 - 30,319,013 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	8	32,950,878 - 33,018,245 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	32,950,875 - 33,017,854 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	32,973,711 - 33,040,595 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	31,572,341 - 31,659,306 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	31,710,513 - 31,778,220 (-)	NCBI		Celera
Cytogenetic Map	8	q21	NCBI

BARX2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	129,375,233 - 129,452,279 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	11	129,375,848 - 129,452,279 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	129,245,743 - 129,322,174 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	128,751,091 - 128,827,384 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	128,751,044 - 128,827,025	NCBI
Celera	11	126,414,612 - 126,490,903 (+)	NCBI		Celera
Cytogenetic Map	11	q24.3	NCBI
HuRef	11	125,197,559 - 125,273,843 (+)	NCBI		HuRef
CHM1_1	11	129,131,929 - 129,208,237 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	129,410,744 - 129,487,778 (+)	NCBI		T2T-CHM13v2.0

Barx2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	31,757,340 - 31,824,581 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	31,757,340 - 31,824,758 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	31,846,044 - 31,913,285 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	31,846,044 - 31,913,462 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	31,653,629 - 31,720,870 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	31,595,845 - 31,662,638 (-)	NCBI		MGSCv36	mm8
Celera	9	29,106,200 - 29,173,253 (-)	NCBI		Celera
Cytogenetic Map	9	A4	NCBI

Barx2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	30,345,311 - 30,418,232 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	30,345,837 - 30,418,186 (+)	NCBI	ChiLan1.0	ChiLan1.0

BARX2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	11	131,164,518 - 131,242,079 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	124,187,026 - 124,264,154 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	128,086,441 - 128,162,833 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	128,086,409 - 128,162,833 (+)	Ensembl	panpan1.1		panPan2

BARX2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	5,238,795 - 5,311,027 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	5,239,517 - 5,310,648 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	5,298,474 - 5,372,031 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	5,196,807 - 5,270,452 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	5,197,533 - 5,271,156 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	5,258,336 - 5,331,876 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	5,240,819 - 5,314,348 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	5,268,897 - 5,342,390 (-)	NCBI		UU_Cfam_GSD_1.0

Barx2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	111,533,573 - 111,603,814 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936572	2,846,551 - 2,916,842 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936572	2,846,862 - 2,916,842 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BARX2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	56,261,658 - 56,340,983 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	56,261,394 - 56,340,992 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	62,541,342 - 62,620,933 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BARX2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	120,510,271 - 120,587,689 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	120,572,074 - 120,588,039 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	5,501,279 - 5,576,472 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Barx2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624812	3,720,303 - 3,802,701 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624812	3,720,302 - 3,802,630 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Barx2
312 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	54
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000011386
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	26644912	46711092	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	28157323	30848259	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	29502665	50095447	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat

Markers in Region

RH132744

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,319,129 - 30,319,346 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,018,305 - 33,018,521	NCBI	Rnor6.0
Rnor_5.0	8	33,040,886 - 33,041,102	UniSTS	Rnor5.0
RGSC_v3.4	8	31,640,232 - 31,640,448	UniSTS	RGSC3.4
Celera	8	31,778,280 - 31,778,496	UniSTS
Cytogenetic Map	8	q13	UniSTS

RH132855

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,259,883 - 30,260,721 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	32,959,338 - 32,960,175	NCBI	Rnor6.0
Rnor_5.0	8	32,982,168 - 32,983,005	UniSTS	Rnor5.0
RGSC_v3.4	8	31,580,336 - 31,581,173	UniSTS	RGSC3.4
Celera	8	31,718,982 - 31,719,819	UniSTS
RH 3.4 Map	8	249.4	UniSTS
Cytogenetic Map	8	q13	UniSTS

BM387908

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,316,779 - 30,316,956 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,015,955 - 33,016,131	NCBI	Rnor6.0
Rnor_5.0	8	33,038,536 - 33,038,712	UniSTS	Rnor5.0
RGSC_v3.4	8	31,637,882 - 31,638,058	UniSTS	RGSC3.4
Celera	8	31,775,930 - 31,776,106	UniSTS
RH 3.4 Map	8	250.0	UniSTS
Cytogenetic Map	8	q13	UniSTS

SHGC-152003

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	30,307,718 - 30,308,306 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	33,006,896 - 33,007,483	NCBI	Rnor6.0
Rnor_5.0	8	33,029,477 - 33,030,064	UniSTS	Rnor5.0
RGSC_v3.4	8	31,628,823 - 31,629,410	UniSTS	RGSC3.4
Cytogenetic Map	8	q13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium							5	5					5
Low	1	4	2		2		3	6	50	35	38	9	3
Below cutoff	2	16	18	12	8	12			24		2	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_003750457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_003754397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JACYVU010000190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000011386 ⟹ ENSRNOP00000011386

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	30,251,132 - 30,319,013 (-)	Ensembl
Rnor_6.0 Ensembl	8	32,950,875 - 33,017,854 (-)	Ensembl

RefSeq Acc Id:

XM_003750457 ⟹ XP_003750505

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	30,251,132 - 30,319,105 (-)	NCBI
Rnor_6.0	8	32,950,878 - 33,018,245 (-)	NCBI
Rnor_5.0	8	32,973,711 - 33,040,595 (-)	NCBI

Sequence:

show sequence

CTTTAGCTGGCTCTAGGCTGGGCAGTGAGGAGCGTTGCTGCTTGGAAAACTGGCGGCCCGACTC
CTGAGCCGCCCGAGAAGGCGGTGCGCTCCGGACGTACTGCGCGTGCACACACACGAGCTCGCGC
GCACACCCCGTACACACACCTGAAGCTGGGGGAGGGCGAGAGGAGAACCGAGGCGAGTGTCTTA
AAATAGAGAGCCAGCCCGGCGAGCGCTCGACTCTCGGGACGGCGGGAGGCAGCGAGCAAGAGCG
GTCGGACCCGGGGTGCGCAGGTCAGCACCCCGGCCGCACGGGCGCGCAGGGGCGGGGTAGCAGC
CGACGCCCCTCGGCTCGCGCTCCGCACCTGGCCCTGCAGGAAGTGCGCGCTGATTGACAGCTGC
GGTGTCCCAAAAAGGCTGTAGTCAAAGATGCTGCTCGGCGGGTGGGTGTAGACGCAGCAGGCGC
GCCTGTGCCCTCTCTGTTTCGCGCGCCTCCCCGGGCCCCGCCGCCCCTCTGGCTGCCGAGGAGC
GGGGCTCAGGTCTCCAGGCTCCGGTCCCGGCTCACCATGCACTGCCACGCGGAACTGAGGCTGA
GCTCACCCGGCCAGCTCAAAGCAGCCAGGAGGCGCTACAAGACTTTCATGATCGATGAGATCCT
CTCCAAGGAGACCTGCGACTACTTTGAGAAACTTTCCCTCTACTCTGTGTGCCCATCGCTGGTG
GTGCGACCCAAGCCCCTGCACTCTTGTACCGGTTCTCCTTCCCTACGGGCATATCCTCTCCTGT
CGGTGATCACCCGGCAGCCCACAGTCATCTCCCACCTGGTTCCCACCGGCCCTGGACTCACCCC
AGTTAACACTCGCCACGCAGTTGCTGCTGAGGCTGCTGCTGCCGCTGCCGCCGCCGCCGCTGCC
GCCGCTGCCGAGACCCCTGGTGGCGAGGCATTAGCCAGCAGCGAATCAGAGACAGAACAACCCA
CCCCCAGGCAGAAGAAACCACGCAGGAGTCGCACCATCTTCACGGAGCTGCAGCTCATGGGCCT
AGAGAAGAAATTCCAGAAGCAGAAGTATTTGTCTACCCCAGACAGGTTGGACTTGGCCCAGTCT
CTGGGGCTCACGCAGCTGCAAGTGAAGACTTGGTATCAGAACCGAAGGATGAAGTGGAAGAAGA
TGGTCCTTAAAGGTGGACAGGAAGCACCCACGAAACCTAAGGGGCGCCCCAAGAAGAACTCCAT
TCCCACATCAGAGGAGATCGAAGCGGAAGAGAAAATGAACAGTCAGGCCCAGAGCCAGGAGCAG
CTGGGATCCTTGCAGGGACAGGAGGAACCCCGTGATCCCCAGGAGCCCAAAGCGTGCCTGGTCC
CCTTGGAGGTGGCAGAACCGAGTCAACAGCCCCAGGAGTTGCCAGAAGCTTCCTCTGAACCCCC
ACCATTAAGCTAAACTAAAGTTCTTTAGGGGGAGGGGGAGCCTGGGAAGAAGGGAAGAGAGAAG
CAAGGAGATGCTGACGGAGAGAAGACCGCTAAAGACTAGTCACGTGGGTAGAGGAGCGCTTGCT
GTCTCCCTCCTCCCAGCGGCATTTTCATCTGGAGCACTTGATGAAGACTTACTTGTGTGGGACT
TGCCGTTCTTGCAAGGCTGTGTTAGCCACAGATACCCTTGAGTAAGGGAGATAGCGCCTTGGAT
CTGATTGCCCAGGCTTAGGTGATGGCTTTAGGGCTGGCTGCAGCAGCCTCTTAGTGTGTCGGGC
TGGGCTGGCCTGCAGCAAGGGCTGCTCTTCTCCCTCTGGGCAACAGGTCAGCAAAGCAGGGAGA
AAGGAGGTGGAAGTGCTTGGGAGGCCTGCCCAGGCTCCTTGCTGACTCAGCACTTATTTCTGTA
GTTTTAAGAGAATTGATTTTTTTTTTTGAG

hide sequence

Protein Sequences


Protein RefSeqs	XP_003750505	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

XP_003750505 ⟸ XM_003750457

- UniProtKB:

D4A7E7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGS
PSLRAYPLLSVITRQPTVISHLVPTGPGLTPVNTRHAVAAEAAAAAAAAAAAAAAETPGGEALA
SSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWY
QNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQEQLGSLQGQEEPRD
PQEPKACLVPLEVAEPSQQPQELPEASSEPPPLS

hide sequence

RefSeq Acc Id:

ENSRNOP00000011386 ⟸ ENSRNOT00000011386

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A7E7-F1-model_v2	AlphaFold	D4A7E7	1-290	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695830

Promoter ID:

EPDNEW_R6354

Type:

single initiation site

Name:

Barx2_1

Description:

BARX homeobox 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	33,017,825 - 33,017,885	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1584840	AgrOrtholog
BioCyc Gene	G2FUF-31251	BioCyc
Ensembl Genes	ENSRNOG00000008592	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000011386	ENTREZGENE
	ENSRNOP00000011386.6	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011386	ENTREZGENE
	ENSRNOT00000011386.8	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_eu	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	HTH_lambrepressr	UniProtKB/TrEMBL
KEGG Report	rno:679701	UniProtKB/TrEMBL
NCBI Gene	679701	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN BARH-LIKE	UniProtKB/TrEMBL
	HOMEOBOX PROTEIN BARH-LIKE 2	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
PhenoGen	Barx2	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
	HTHREPRESSR	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	D4A7E7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-03-05	Barx2	BARX homeobox 2	Barx2-ps1	BARX homeobox 2, pseudogene 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-06-07	Barx2-ps1	BARX homeobox 2, pseudogene 1	Barx2	BARX homeobox 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Barx2	BARX homeobox 2	Barx2	BarH-like homeobox 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Barx2	BarH-like homeobox 2	LOC679701	similar to BarH-like homeobox 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC679701	similar to BarH-like homeobox 2	LOC679497	similar to BarH-like homeobox 2	Data Merged	1643240	APPROVED
2006-11-19	LOC679701	similar to BarH-like homeobox 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC679497	similar to BarH-like homeobox 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar