Advanced Search (OLGA)

Gene: Bpifb1 (BPI fold containing family B, member 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Bpifb1

Name:

BPI fold containing family B, member 1

RGD ID:

1563047

Description:

Predicted to enable lipid binding activity. Predicted to be involved in innate immune response in mucosa and negative regulation of toll-like receptor 4 signaling pathway. Predicted to be located in extracellular region. Orthologous to human BPIFB1 (BPI fold containing family B member 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; methoxychlor.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

BPI fold-containing family B member 1; fold containing family B, member 1; LOC499926; long palate, lung and nasal epithelium carcinoma-associated protein 1; Lplunc1; MGC156708; RGD1563047; similar to von Ebner minor salivary gland protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	163,133,151 - 163,166,420 (+)	NCBI		GRCr8
mRatBN7.2	3	142,672,995 - 142,706,258 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	142,672,995 - 142,706,256 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	146,574,903 - 146,608,241 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	155,158,749 - 155,192,083 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	152,898,994 - 152,932,322 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	149,668,099 - 149,702,399 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	149,668,102 - 149,702,399 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	156,046,295 - 156,078,742 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	144,601,201 - 144,635,308 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	141,413,918 - 141,446,549 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb1	Rat	glutathione synthetase deficiency		ISO	BPIFB1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: PYROGLUTAMIC ACIDURIA	ClinVar	PMID:12638941 more ...
Bpifb1	Rat	glutatione synthetase deficiency with 5-oxoprolinuria		ISO	BPIFB1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: 5-OXOPROLINURIA DUE TO GLUTATHIONE SYNTHETASE DEFICIENCY	ClinVar	PMID:12638941 more ...
Bpifb1	Rat	hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase		ISO	BPIFB1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase	ClinVar	PMID:15024124 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb1	Rat	(R,R,R)-alpha-tocopherol	multiple interactions	ISO	BPIFB1 (Homo sapiens)	6480464	[alpha-Tocopherol co-treated with hempseed oil co-treated with Glycerol co-treated with Propylene Glycol] results in decreased secretion of BPIFB1 protein	CTD	PMID:36372912
Bpifb1	Rat	17beta-estradiol	multiple interactions	ISO	BPIFB1 (Homo sapiens)	6480464	[Estradiol binds to ESR2 protein] which results in increased expression of BPIFB1 mRNA	CTD	PMID:20404318
Bpifb1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of BPIFB1 mRNA	CTD	PMID:33387578
Bpifb1	Rat	aflatoxin B1	decreases methylation	ISO	BPIFB1 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of BPIFB1 gene	CTD	PMID:27153756
Bpifb1	Rat	Aflatoxin B2 alpha	increases methylation	ISO	BPIFB1 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of BPIFB1 intron	CTD	PMID:30157460
Bpifb1	Rat	all-trans-retinoic acid	multiple interactions	ISO	Bpifb1 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of BPIFB1 mRNA	CTD	PMID:36189433
Bpifb1	Rat	arsane	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	Arsenic results in increased expression of BPIFB1 mRNA	CTD	PMID:23221970
Bpifb1	Rat	arsane	decreases expression	ISO	BPIFB1 (Homo sapiens)	6480464	Arsenic results in decreased expression of BPIFB1 mRNA	CTD	PMID:36861143
Bpifb1	Rat	arsenic atom	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	Arsenic results in increased expression of BPIFB1 mRNA	CTD	PMID:23221970
Bpifb1	Rat	arsenic atom	decreases expression	ISO	BPIFB1 (Homo sapiens)	6480464	Arsenic results in decreased expression of BPIFB1 mRNA	CTD	PMID:36861143
Bpifb1	Rat	benzene	decreases expression	ISO	Bpifb1 (Mus musculus)	6480464	Benzene results in decreased expression of BPIFB1 mRNA	CTD	PMID:34624356
Bpifb1	Rat	benzo[a]pyrene	decreases expression	ISO	BPIFB1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of BPIFB1 mRNA	CTD	PMID:21871943
Bpifb1	Rat	benzo[a]pyrene	affects methylation	ISO	BPIFB1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of BPIFB1 exon and Benzo(a)pyrene affects the methylation of BPIFB1 promoter	CTD	PMID:27901495
Bpifb1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of BPIFB1 mRNA	CTD	PMID:25181051
Bpifb1	Rat	bisphenol A	decreases methylation	ISO	BPIFB1 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of BPIFB1 gene	CTD	PMID:31601247
Bpifb1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of BPIFB1 mRNA	CTD	PMID:34947998
Bpifb1	Rat	bisphenol A	decreases methylation	ISO	Bpifb1 (Mus musculus)	6480464	bisphenol A results in decreased methylation of BPIFB1 promoter	CTD	PMID:27312807
Bpifb1	Rat	bisphenol A	increases methylation	ISO	Bpifb1 (Mus musculus)	6480464	bisphenol A results in increased methylation of BPIFB1 promoter	CTD	PMID:27312807
Bpifb1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of BPIFB1 mRNA	CTD	PMID:30816183 and PMID:32528016
Bpifb1	Rat	carbon nanotube	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of BPIFB1 mRNA	CTD	PMID:25554681
Bpifb1	Rat	carbon nanotube	decreases expression	ISO	Bpifb1 (Mus musculus)	6480464	Nanotubes and Carbon results in decreased expression of BPIFB1 mRNA	CTD	PMID:25554681
Bpifb1	Rat	chloroprene	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	Chloroprene results in increased expression of BPIFB1 mRNA	CTD	PMID:23125180
Bpifb1	Rat	clofibrate	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	Clofibrate results in increased expression of BPIFB1 mRNA	CTD	PMID:17585979
Bpifb1	Rat	genistein	decreases expression	ISO	Bpifb1 (Mus musculus)	6480464	Genistein results in decreased expression of BPIFB1 mRNA	CTD	PMID:32186404
Bpifb1	Rat	glycerol	multiple interactions	ISO	BPIFB1 (Homo sapiens)	6480464	[alpha-Tocopherol co-treated with hempseed oil co-treated with Glycerol co-treated with Propylene Glycol] results in decreased secretion of BPIFB1 protein and [hempseed oil co-treated with Glycerol co-treated with Propylene Glycol] results in decreased secretion of BPIFB1 protein	CTD	PMID:36372912
Bpifb1	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of BPIFB1 gene	CTD	PMID:35440735
Bpifb1	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	Bpifb1 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of BPIFB1 mRNA	CTD	PMID:36189433
Bpifb1	Rat	ozone	multiple interactions	ISO	Bpifb1 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of BPIFB1 mRNA	CTD	PMID:34911549
Bpifb1	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of BPIFB1 mRNA	CTD	PMID:32680482
Bpifb1	Rat	perfluorooctane-1-sulfonic acid	affects expression	ISO	BPIFB1 (Homo sapiens)	6480464	perfluorooctane sulfonic acid affects the expression of BPIFB1 protein	CTD	PMID:38537583
Bpifb1	Rat	pioglitazone	multiple interactions	ISO	Bpifb1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of BPIFB1 mRNA	CTD	PMID:27935865
Bpifb1	Rat	propane-1,2-diol	multiple interactions	ISO	BPIFB1 (Homo sapiens)	6480464	[alpha-Tocopherol co-treated with hempseed oil co-treated with Glycerol co-treated with Propylene Glycol] results in decreased secretion of BPIFB1 protein and [hempseed oil co-treated with Glycerol co-treated with Propylene Glycol] results in decreased secretion of BPIFB1 protein	CTD	PMID:36372912
Bpifb1	Rat	quartz	multiple interactions	EXP		6480464	Tobacco Smoke Pollution promotes the reaction [Quartz results in increased expression of BPIFB1 mRNA]	CTD	PMID:32976597
Bpifb1	Rat	quartz	increases expression	EXP		6480464	Quartz results in increased expression of BPIFB1 mRNA	CTD	PMID:32976597
Bpifb1	Rat	resveratrol	multiple interactions	ISO	BPIFB1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of BPIFB1 mRNA	CTD	PMID:23557933
Bpifb1	Rat	silicon dioxide	decreases expression	ISO	BPIFB1 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of BPIFB1 mRNA	CTD	PMID:25895662
Bpifb1	Rat	sodium arsenite	decreases expression	ISO	BPIFB1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of BPIFB1 mRNA	CTD	PMID:34032870
Bpifb1	Rat	sodium arsenite	decreases expression	ISO	Bpifb1 (Mus musculus)	6480464	sodium arsenite results in decreased expression of BPIFB1 mRNA	CTD	PMID:37682722
Bpifb1	Rat	tetrachloromethane	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of BPIFB1 mRNA	CTD	PMID:25270620
Bpifb1	Rat	titanium dioxide	decreases expression	ISO	Bpifb1 (Mus musculus)	6480464	titanium dioxide results in decreased expression of BPIFB1 mRNA	CTD	PMID:23557971
Bpifb1	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of BPIFB1 mRNA	CTD	PMID:30012374
Bpifb1	Rat	tremolite asbestos	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	tremolite results in increased expression of BPIFB1 mRNA	CTD	PMID:29279043
Bpifb1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of BPIFB1 mRNA	CTD	PMID:33387578
Bpifb1	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of BPIFB1 gene	CTD	PMID:31079544
Bpifb1	Rat	XL147	multiple interactions	ISO	Bpifb1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of BPIFB1 mRNA	CTD	PMID:27935865
Bpifb1	Rat	zinc atom	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	Zinc deficiency results in increased expression of BPIFB1 mRNA	CTD	PMID:20857495
Bpifb1	Rat	zinc(0)	increases expression	ISO	Bpifb1 (Mus musculus)	6480464	Zinc deficiency results in increased expression of BPIFB1 mRNA	CTD	PMID:20857495

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb1	Rat	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bpifb1	Rat	innate immune response	involved_in	IEA	UniProtKB-KW:KW-0399	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bpifb1	Rat	innate immune response in mucosa	involved_in	IEA	UniProtKB:Q8TDL5 and ensembl:ENSP00000253354	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bpifb1	Rat	innate immune response in mucosa	involved_in	IBA	PANTHER:PTN002933992 and UniProtKB:Q8TDL5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bpifb1	Rat	innate immune response in mucosa	involved_in	ISO	BPIFB1 (Homo sapiens)	1624291	PMID:21900486	RGD	PMID:21900486
Bpifb1	Rat	negative regulation of toll-like receptor 4 signaling pathway	involved_in	IEA	UniProtKB:Q8TDL5 and ensembl:ENSP00000253354	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bpifb1	Rat	negative regulation of toll-like receptor 4 signaling pathway	involved_in	IBA	PANTHER:PTN002933992 and UniProtKB:Q8TDL5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bpifb1	Rat	negative regulation of toll-like receptor 4 signaling pathway	involved_in	ISO	BPIFB1 (Homo sapiens)	1624291	PMID:21900486	RGD	PMID:21900486

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb1	Rat	extracellular region	located_in	ISO	BPIFB1 (Homo sapiens)	1624291	PMID:20237794	RGD	PMID:20237794
Bpifb1	Rat	extracellular region	located_in	IEA	UniProtKB:Q8TDL5 and ensembl:ENSP00000253354	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bpifb1	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Bpifb1	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bpifb1	Rat	extracellular space	located_in	IEA	InterPro:IPR021193	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb1	Rat	lipid binding	enables	IEA	InterPro:IPR001124 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334	PMID:19056867	PMID:19199708	PMID:20237794	PMID:21787333	PMID:21900486

Bpifb1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	163,133,151 - 163,166,420 (+)	NCBI		GRCr8
mRatBN7.2	3	142,672,995 - 142,706,258 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	142,672,995 - 142,706,256 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	146,574,903 - 146,608,241 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	155,158,749 - 155,192,083 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	152,898,994 - 152,932,322 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	149,668,099 - 149,702,399 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	149,668,102 - 149,702,399 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	156,046,295 - 156,078,742 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	144,601,201 - 144,635,308 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	141,413,918 - 141,446,549 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

BPIFB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	33,283,214 - 33,309,871 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	33,273,480 - 33,309,871 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	31,871,020 - 31,897,677 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	31,334,602 - 31,361,345 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	31,334,601 - 31,361,345	NCBI
Celera	20	28,624,683 - 28,651,429 (+)	NCBI		Celera
Cytogenetic Map	20	q11.21	NCBI
HuRef	20	28,658,391 - 28,685,136 (+)	NCBI		HuRef
CHM1_1	20	31,771,823 - 31,798,564 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	35,000,716 - 35,037,069 (+)	NCBI		T2T-CHM13v2.0

Bpifb1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	154,032,738 - 154,062,263 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	154,032,738 - 154,062,289 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	154,190,818 - 154,220,343 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	154,190,818 - 154,220,369 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	154,016,554 - 154,046,079 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	153,882,259 - 153,911,784 (+)	NCBI		MGSCv36	mm8
MGSCv36	2	155,008,637 - 155,038,232 (+)	NCBI		MGSCv36	mm8
Celera	2	160,106,511 - 160,137,967 (+)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	76.23	NCBI

Bpifb1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	27,950,918 - 27,975,146 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	27,955,298 - 27,976,051 (-)	NCBI	ChiLan1.0	ChiLan1.0

BPIFB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	38,978,220 - 39,002,814 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	38,971,318 - 38,995,913 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	29,572,667 - 29,599,158 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	30,688,567 - 30,715,127 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	30,688,567 - 30,715,127 (+)	Ensembl	panpan1.1		panPan2

BPIFB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	22,510,890 - 22,531,338 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	22,511,060 - 22,531,292 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	22,156,613 - 22,176,946 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	23,196,973 - 23,217,311 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	23,197,026 - 23,217,263 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	22,473,860 - 22,492,601 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	22,582,584 - 22,602,919 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	23,013,693 - 23,034,035 (+)	NCBI		UU_Cfam_GSD_1.0

Bpifb1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	171,496,241 - 171,513,905 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936561	7,227,045 - 7,277,393 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BPIFB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	36,782,307 - 36,809,754 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	36,782,307 - 36,809,756 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	41,731,739 - 41,760,090 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BPIFB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	37,612,111 - 37,638,397 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666050	89,259,895 - 89,287,518 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bpifb1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624842	5,951,203 - 5,972,212 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624842	5,951,202 - 5,972,212 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Bpifb1
131 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	74
Count of miRNA genes:	59
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000055342
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141339236	155617360	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
4	5	27	104	50	49	22	11	22	3	115	57	87	28	58	27


RefSeq Transcripts	NM_001077680	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006235355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC127515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000055342 ⟹ ENSRNOP00000052209

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	142,672,995 - 142,706,256 (+)	Ensembl
Rnor_6.0 Ensembl	3	149,668,102 - 149,702,399 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105121 ⟹ ENSRNOP00000094613

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	142,672,995 - 142,703,803 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108761 ⟹ ENSRNOP00000094209

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	142,685,210 - 142,706,256 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118757 ⟹ ENSRNOP00000082300

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	142,682,938 - 142,706,256 (+)	Ensembl

RefSeq Acc Id:

NM_001077680 ⟹ NP_001071148

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	163,133,151 - 163,166,418 (+)	NCBI
mRatBN7.2	3	142,672,995 - 142,706,256 (+)	NCBI
Rnor_6.0	3	149,668,195 - 149,702,397 (+)	NCBI
Rnor_5.0	3	156,046,295 - 156,078,742 (+)	NCBI
RGSC_v3.4	3	144,601,201 - 144,635,308 (+)	RGD
Celera	3	141,413,918 - 141,446,549 (+)	RGD

Sequence:

show sequence

GAATTTGCTTCGCTTGGGTCTTAGAGGCTCTGCTCCTGGACACCCCAAGCCATGAAGATGACCAACCCATGGATCGTCAGCCTCCTGCTGGGAGCCACACTGGTCCAAGCTAACCTCTATCCTCCTGC
AGTGCTCAACCTTGGCCCAGAAGTCATCAAGAAGCACCTGACCCAGGCACTGGAGAACCACGATGCCACTGCCATCCTCCAGGAGTTGCCGCTGCTCAGAGGCATGCAAGATAAGTCTGGCAGCATCC
CCATATTGGACAGCTTCGTGAACACTGTTCTGAGATACATCATCTGGATGAAGGTCACCTCTGCTAACATTCTCCAGCTGGTTGTGCAGCCTTCAACCTATGACCAGGAGCTGGTAGTCAGAATCCCC
CTGGACATGGTGGCTGGATTAAACACGCCACTGATCAAGACCATAGTGGAGTTCCAAATGAGCACCGAGGTCCAAGCCCTCATCCGGGTGGAGAGGAGCAAGAACGGCCCTGCCCGCCTGAACCTCAG
TGACTGTTCCAGCAACGAGAGCACGCTGCGCCTCAGCCTGCTTCACAAGCTCTCCTTCGTGGTCAACTCCTTGGCAAAGAACGTTATGAATCTCCTGATGCCAGCCCTGCCCCAAATAGTGAAAAGCC
ACCTGTGCCCTGTGATCCAGCAGGCCTTTGATGACATGTACGAAGACTTCCTGAGGCTGACCACAGCACCCATTGCCCTCAGCCCTGGAGCCCTGGAGTTTGACCTTCTGTCTCCTGCCATCCAGGAC
AGTAACATCCTGTTCAACCTGAAGGCCAAGCTGCTGGACTCACAGGCAAGGGTAACCAACTGGTTCAACGGCTCTGCGACTCCTCTGATGGAGACCACCCCAGACAGGGCCCCTTTCAGCCTGACTGT
GAGGCAGGACCTAGTGAATGCCATTGTGACCACCCTGATCCCCCAGGAGGAGCTTGTAATCCTGCTCAGATTCGTGATTCCTGATGTGGCCCGCCAGTTACAGATGGACATCAAGGAGATCAATGCAG
AGGCAGCCAACAAGTTGGGGCCCACCCAGATGTTGAAGATCTTCACTCACAGCACCCCCCATATTGTGCTGAATGAGGGCGGTGCCACGGCAGCCCAAAGTGTTGTACTGGAAGTGTTCCCCACCAAT
ACAGATGTCCGACCCTTCTTCTCTCTCGGCATTGAAGCCAGTTATGAAGCTCAGTTTTTCATAGCAGAAAACCGACTTATGCTCAACTTCAATAACGTCAGTATCGAGCGCATCAAGCTGATGATCTC
GGATATCAAACTGTTCGATCCTGAAGTCCTGAAGGACACTCTGACCAAGATCCTTGAGTACACATTGCTGCCCAATGAGAATGGCAAACTGAGGACTGGAATCCCCATGTCAATGCCCAAGGCCTTGG
GGTATGAGAAAGCCATGTGGTCTGTGAGCAAGGGTGCCCTCAAGCTCACTCCAGCCTCCTCCTAGGACCCTGGCTCTCCTCCCTCCTGATGAAGACCTGGACAGTAGCAGCCAGCCCCGGCCAGGTCC
CAGCTGGGAATGTGGAAGCCTGCCATGTAGACTATTCCCCTGCAATTAATAAACACTTGCCAGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006235355 ⟹ XP_006235417

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	163,143,103 - 163,166,420 (+)	NCBI
mRatBN7.2	3	142,682,947 - 142,706,258 (+)	NCBI
Rnor_6.0	3	149,678,378 - 149,702,399 (+)	NCBI
Rnor_5.0	3	156,046,295 - 156,078,742 (+)	NCBI

Sequence:

show sequence

GGTCTTGGCCCACATGCTCAAGGTGGCCTGCCCAAGTCTGGATGCAAGATATAAGGCTGGGTCTCCAAACTCACCACCGAGGAGAGGAGCAGGCAGACCCAGGACTCCAGCACATTCAGCCATGAAGA
TGACCAACCCATGGATCGTCAGCCTCCTGCTGGGAGCCACACTGGTCCAAGCTAACCTCTATCCTCCTGCAGTGCTCAACCTTGGCCCAGAAGTCATCAAGAAGCACCTGACCCAGGCACTGGAGAAC
CACGATGCCACTGCCATCCTCCAGGAGTTGCCGCTGCTCAGAGGCATGCAAGATAAGTCTGGCAGCATCCCCATATTGGACAGCTTCGTGAACACTGTTCTGAGATACATCATCTGGATGAAGGTCAC
CTCTGCTAACATTCTCCAGCTGGTTGTGCAGCCTTCAACCTATGACCAGGAGCTGGTAGTCAGAATCCCCCTGGACATGGTGGCTGGATTAAACACGCCACTGATCAAGACCATAGTGGAGTTCCAAA
TGAGCACCGAGGTCCAAGCCCTCATCCGGGTGGAGAGGAGCAAGAACGGCCCTGCCCGCCTGAACCTCAGTGACTGTTCCAGCAACGAGAGCACGCTGCGCCTCAGCCTGCTTCACAAGCTCTCCTTC
GTGGTCAACTCCTTGGCAAAGAACGTTATGAATCTCCTGATGCCAGCCCTGCCCCAAATAGTGAAAAGCCACCTGTGCCCTGTGATCCAGCAGGCCTTTGATGACATGTACGAAGACTTCCTGAGGCT
GACCACAGCACCCATTGCCCTCAGCCCTGGAGCCCTGGAGTTTGACCTTCTGTCTCCTGCCATCCAGGACAGTAACATCCTGTTCAACCTGAAGGCCAAGCTGCTGGACTCACAGGCAAGGGTAACCA
ACTGGTTCAACGGCTCTGCGACTCCTCTGATGGAGACCACCCCAGACAGGGCCCCTTTCAGCCTGACTGTGAGGCAGGACCTAGTGAATGCCATTGTGACCACCCTGATCCCCCAGGAGGAGCTTGTA
ATCCTGCTCAGATTCGTGATTCCTGATGTGGCCCGCCAGTTACAGATGGACATCAAGGAGATCAATGCAGAGGCAGCCAACAAGTTGGGGCCCACCCAGATGTTGAAGATCTTCACTCACAGCACCCC
CCATATTGTGCTGAATGAGGGCGGTGCCACGGCAGCCCAAAGTGTTGTACTGGAAGTGTTCCCCACCAATACAGATGTCCGACCCTTCTTCTCTCTCGGCATTGAAGCCAGTTATGAAGCTCAGTTTT
TCATAGCAGAAAACCGACTTATGCTCAACTTCAATAACGTCAGTATCGAGCGCATCAAGCTGATGATCTCGGATATCAAACTGTTCGATCCTGAAGTCCTGAAGGACACTCTGACCAAGATCCTTGAG
TACACATTGCTGCCCAATGAGAATGGCAAACTGAGGACTGGAATCCCCATGTCAATGCCCAAGGCCTTGGGGTATGAGAAAGCCATGTGGTCTGTGAGCAAGGGTGCCCTCAAGCTCACTCCAGCCTC
CTCCTAGGACCCTGGCTCTCCTCCCTCCTGATGAAGACCTGGACAGTAGCAGCCAGCCCCGGCCAGGTCCCAGCTGGGAATGTGGAAGCCTGCCATGTAGACTATTCCCCTGCAATTAATAAACACTT
GCCAGTGGC

hide sequence


Protein RefSeqs	NP_001071148	(Get FASTA)	NCBI Sequence Viewer
	XP_006235417	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A0JPN3	(Get FASTA)	NCBI Sequence Viewer
	AAI27516	(Get FASTA)	NCBI Sequence Viewer
	EDL85975	(Get FASTA)	NCBI Sequence Viewer
	EDL85976	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000052209
	ENSRNOP00000082300

RefSeq Acc Id:	NP_001071148 ⟸ NM_001077680
- Peptide Label:	precursor
- UniProtKB:	A0JPN3 (UniProtKB/Swiss-Prot), A0A140TAH2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKMTNPWIVSLLLGATLVQANLYPPAVLNLGPEVIKKHLTQALENHDATAILQELPLLRGMQDKSGSIPILDSFVNTVLRYIIWMKVTSANILQLVVQPSTYDQELVVRIPLDMVAGLNTPLIKTIVE FQMSTEVQALIRVERSKNGPARLNLSDCSSNESTLRLSLLHKLSFVVNSLAKNVMNLLMPALPQIVKSHLCPVIQQAFDDMYEDFLRLTTAPIALSPGALEFDLLSPAIQDSNILFNLKAKLLDSQAR VTNWFNGSATPLMETTPDRAPFSLTVRQDLVNAIVTTLIPQEELVILLRFVIPDVARQLQMDIKEINAEAANKLGPTQMLKIFTHSTPHIVLNEGGATAAQSVVLEVFPTNTDVRPFFSLGIEASYEA QFFIAENRLMLNFNNVSIERIKLMISDIKLFDPEVLKDTLTKILEYTLLPNENGKLRTGIPMSMPKALGYEKAMWSVSKGALKLTPASS hide sequence

RefSeq Acc Id:	XP_006235417 ⟸ XM_006235355
- Peptide Label:	isoform X1
- UniProtKB:	A0JPN3 (UniProtKB/Swiss-Prot), A0A8I5ZV17 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLKVACPSLDARYKAGSPNSPPRRGAGRPRTPAHSAMKMTNPWIVSLLLGATLVQANLYPPAVLNLGPEVIKKHLTQALENHDATAILQELPLLRGMQDKSGSIPILDSFVNTVLRYIIWMKVTSANI LQLVVQPSTYDQELVVRIPLDMVAGLNTPLIKTIVEFQMSTEVQALIRVERSKNGPARLNLSDCSSNESTLRLSLLHKLSFVVNSLAKNVMNLLMPALPQIVKSHLCPVIQQAFDDMYEDFLRLTTAP IALSPGALEFDLLSPAIQDSNILFNLKAKLLDSQARVTNWFNGSATPLMETTPDRAPFSLTVRQDLVNAIVTTLIPQEELVILLRFVIPDVARQLQMDIKEINAEAANKLGPTQMLKIFTHSTPHIVL NEGGATAAQSVVLEVFPTNTDVRPFFSLGIEASYEAQFFIAENRLMLNFNNVSIERIKLMISDIKLFDPEVLKDTLTKILEYTLLPNENGKLRTGIPMSMPKALGYEKAMWSVSKGALKLTPASS hide sequence

Ensembl Acc Id:

ENSRNOP00000052209 ⟸ ENSRNOT00000055342

Ensembl Acc Id:

ENSRNOP00000082300 ⟸ ENSRNOT00000118757

Ensembl Acc Id:

ENSRNOP00000094209 ⟸ ENSRNOT00000108761

Protein Domains

Lipid-binding serum glycoprotein N-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0JPN3-F1-model_v2	AlphaFold	A0JPN3	1-471	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692569

Promoter ID:

EPDNEW_R3094

Type:

single initiation site

Name:

Bpifb1_1

Description:

BPI fold containing family B, member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	149,668,097 - 149,668,157	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-47187	BioCyc
Ensembl Genes	ENSRNOG00000015468	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000055342	ENTREZGENE
	ENSRNOT00000118757	ENTREZGENE
Gene3D-CATH	Bactericidal permeability-increasing protein, domain 1	UniProtKB/Swiss-Prot
	Bactericidal permeability-increasing protein, domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7100079	IMAGE-MGC_LOAD
InterPro	Bactericidal_perm-incr_a/b_dom	UniProtKB/Swiss-Prot
	Bpifb1	UniProtKB/Swiss-Prot
	Lipid-bd_serum_glycop_C	UniProtKB/Swiss-Prot
	Lipid-bd_serum_glycop_N	UniProtKB/Swiss-Prot
KEGG Report	rno:499926	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156708	IMAGE-MGC_LOAD
NCBI Gene	499926	ENTREZGENE
PANTHER	BPI FOLD-CONTAINING FAMILY B MEMBER 1	UniProtKB/Swiss-Prot
	PTHR47395	UniProtKB/Swiss-Prot
Pfam	LBP_BPI_CETP	UniProtKB/Swiss-Prot
	LBP_BPI_CETP_C	UniProtKB/Swiss-Prot
PhenoGen	Bpifb1	PhenoGen
RatGTEx	ENSRNOG00000015468	RatGTEx
SMART	BPI1	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF55394	UniProtKB/Swiss-Prot
UniProt	A0A140TAH2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZV17	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AJ25_RAT	UniProtKB/TrEMBL
	A0A8I6AL65_RAT	UniProtKB/TrEMBL
	A0JPN3	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-16	Bpifb1	BPI fold containing family B, member 1	Bpifb1	fold containing family B, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-01	Bpifb1	fold containing family B, member 1	RGD1563047	similar to von Ebner minor salivary gland protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1563047	similar to von Ebner minor salivary gland protein	RGD1563047_predicted	similar to von Ebner minor salivary gland protein (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1563047_predicted	similar to von Ebner minor salivary gland protein (predicted)	LOC499926	similar to von Ebner minor salivary gland protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499926	similar to von Ebner minor salivary gland protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar