Advanced Search (OLGA)

Gene: Bpifb4 (BPI fold containing family B, member 4) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Bpifb4

Name:

BPI fold containing family B, member 4

RGD ID:

1561174

Description:

Predicted to enable lipid binding activity. Predicted to be located in actin cytoskeleton and cytosol. Orthologous to human BPIFB4 (BPI fold containing family B member 4); INTERACTS WITH atrazine; bisphenol A; naphthalene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

BPI fold-containing family B member 4; ligand-binding protein RY2G5; long palate, lung and nasal epithelium carcinoma-associated protein 4; Lplunc4; potential ligand-binding protein; RY2G5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	162,881,478 - 162,908,207 (+)	NCBI		GRCr8
mRatBN7.2	3	142,423,571 - 142,448,044 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	142,400,976 - 142,448,044 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	146,325,494 - 146,349,942 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	154,909,321 - 154,933,779 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	152,649,656 - 152,674,057 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	149,424,392 - 149,449,350 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	149,424,392 - 149,449,350 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	155,802,169 - 155,827,127 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	144,325,761 - 144,350,230 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	141,164,705 - 141,189,176 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb4	Rat	glutathione synthetase deficiency		ISO	RGD:1344811	8554872	ClinVar Annotator: match by term: PYROGLUTAMIC ACIDURIA	ClinVar	PMID:12638941\|PMID:15717202\|PMID:28492532
Bpifb4	Rat	glutatione synthetase deficiency with 5-oxoprolinuria		ISO	RGD:1344811	8554872	ClinVar Annotator: match by term: 5-OXOPROLINURIA DUE TO GLUTATHIONE SYNTHETASE DEFICIENCY	ClinVar	PMID:12638941\|PMID:15717202\|PMID:28492532
Bpifb4	Rat	hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase		ISO	RGD:1344811	8554872	ClinVar Annotator: match by term: Hypermethioninemia with deficiency of S-adenosylhomocysteine hydrolase	ClinVar	PMID:15024124\|PMID:20852937\|PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb4	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1344811	6480464	bisphenol S results in decreased expression of BPIFB4 mRNA	CTD	PMID:27685785
Bpifb4	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	RGD:1620426	6480464	bisphenol S results in increased methylation of BPIFB4 exon	CTD	PMID:33297965
Bpifb4	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of BPIFB4 mRNA	CTD	PMID:36841081
Bpifb4	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1344811	6480464	Benzo(a)pyrene affects the methylation of BPIFB4 exon	CTD	PMID:27901495
Bpifb4	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of BPIFB4 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016
Bpifb4	Rat	bisphenol A	decreases expression	ISO	RGD:1620426	6480464	bisphenol A results in decreased expression of BPIFB4 mRNA	CTD	PMID:32156529
Bpifb4	Rat	methidathion	increases expression	ISO	RGD:1620426	6480464	methidathion results in increased expression of BPIFB4 mRNA	CTD	PMID:34813904
Bpifb4	Rat	N-nitrosodiethylamine	multiple interactions	ISO	RGD:1620426	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of BPIFB4 gene	CTD	PMID:23968726
Bpifb4	Rat	naphthalene	decreases expression	EXP		6480464	naphthalene analog results in decreased expression of BPIFB4 mRNA	CTD	PMID:24976557
Bpifb4	Rat	piperonyl butoxide	multiple interactions	ISO	RGD:1620426	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of BPIFB4 gene	CTD	PMID:23968726
Bpifb4	Rat	potassium dichromate	decreases expression	ISO	RGD:1620426	6480464	Potassium Dichromate results in decreased expression of BPIFB4 mRNA	CTD	PMID:23608068
Bpifb4	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of BPIFB4 mRNA	CTD	PMID:33387578
Bpifb4	Rat	triphenyl phosphate	decreases expression	ISO	RGD:1344811	6480464	triphenyl phosphate results in decreased expression of BPIFB4 mRNA	CTD	PMID:28934090
Bpifb4	Rat	troglitazone	decreases expression	ISO	RGD:1344811	6480464	troglitazone results in decreased expression of BPIFB4 mRNA	CTD	PMID:28934090
Bpifb4	Rat	valproic acid	increases methylation	ISO	RGD:1344811	6480464	Valproic Acid results in increased methylation of BPIFB4 gene	CTD	PMID:29154799

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb4	Rat	actin cytoskeleton	located_in	IEA	UniProtKB:P59827\|ensembl:ENSP00000364632	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bpifb4	Rat	actin cytoskeleton	located_in	ISO	RGD:1344811\|UniProtKB:P59827-1	1624291		RGD	GO_REF:0000052
Bpifb4	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Bpifb4	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bpifb4	Rat	cytoplasm	located_in	IEA	UniProtKB:P59826\|ensembl:ENSP00000364643	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bpifb4	Rat	cytosol	located_in	IEA	UniProtKB:P59827\|ensembl:ENSP00000364632	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Bpifb4	Rat	cytosol	located_in	ISO	RGD:1344811\|UniProtKB:P59827-1	1624291		RGD	GO_REF:0000052
Bpifb4	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Bpifb4	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bpifb4	Rat	lipid binding	enables	IEA	InterPro:IPR001124\|InterPro:IPR017942\|InterPro:IPR017943	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1915264	PMID:14739326	PMID:21787333

Bpifb4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	162,881,478 - 162,908,207 (+)	NCBI		GRCr8
mRatBN7.2	3	142,423,571 - 142,448,044 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	142,400,976 - 142,448,044 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	146,325,494 - 146,349,942 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	154,909,321 - 154,933,779 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	152,649,656 - 152,674,057 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	149,424,392 - 149,449,350 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	149,424,392 - 149,449,350 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	155,802,169 - 155,827,127 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	144,325,761 - 144,350,230 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	141,164,705 - 141,189,176 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

BPIFB4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	33,079,643 - 33,111,751 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	33,079,643 - 33,111,751 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	31,667,449 - 31,699,557 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	31,134,416 - 31,163,218 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	31,134,415 - 31,163,217	NCBI
Celera	20	28,423,195 - 28,453,431 (+)	NCBI		Celera
Cytogenetic Map	20	q11.21	NCBI
HuRef	20	28,456,441 - 28,486,360 (+)	NCBI		HuRef
CHM1_1	20	31,569,450 - 31,600,637 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	34,806,383 - 34,838,494 (+)	NCBI		T2T-CHM13v2.0

Bpifb4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	153,780,137 - 153,805,772 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	153,780,141 - 153,806,021 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	153,938,217 - 153,963,852 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	153,938,221 - 153,964,101 (+)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	2	153,938,212 - 153,964,101 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	153,766,598 - 153,789,588 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	153,635,364 - 153,655,293 (+)	NCBI		MGSCv36	mm8
Celera	2	159,777,486 - 159,800,795 (+)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	75.99	NCBI

Bpifb4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	28,167,179 - 28,188,613 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	28,166,892 - 28,190,403 (-)	NCBI	ChiLan1.0	ChiLan1.0

BPIFB4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	38,768,992 - 38,801,037 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	38,762,097 - 38,794,222 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	29,365,756 - 29,397,786 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	30,484,734 - 30,516,954 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	30,484,734 - 30,516,954 (+)	Ensembl	panpan1.1		panPan2

BPIFB4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	22,343,202 - 22,371,513 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	22,344,828 - 22,369,974 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	21,988,777 - 22,015,736 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	23,028,889 - 23,057,272 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	23,028,850 - 23,055,728 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	22,304,485 - 22,331,438 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	22,414,400 - 22,442,868 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	22,845,542 - 22,873,932 (+)	NCBI		UU_Cfam_GSD_1.0

Bpifb4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	171,331,449 - 171,352,876 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	19,764,242 - 19,783,943 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	19,764,242 - 19,783,963 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BPIFB4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	36,609,798 - 36,639,034 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	36,609,805 - 36,639,403 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	41,526,418 - 41,541,772 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BPIFB4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	37,447,136 - 37,479,538 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	37,449,440 - 37,476,276 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	89,424,247 - 89,454,738 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bpifb4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624842	6,194,389 - 6,225,515 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624842	6,194,291 - 6,225,515 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Bpifb4
131 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
3	155804327	155804328	G	A	snv	LEC/Tj (KyushuU)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	43
Count of miRNA genes:	39
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000044574
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141339236	155617360	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	1	39	77	19	23	4	19	4	5	80	64	71	4	38	19


RefSeq Transcripts	NM_001109209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284388	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000044574 ⟹ ENSRNOP00000047586

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	142,400,976 - 142,448,044 (+)	Ensembl
Rnor_6.0 Ensembl	3	149,424,392 - 149,449,350 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000055349 ⟹ ENSRNOP00000052216

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	142,400,976 - 142,444,944 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094034 ⟹ ENSRNOP00000093175

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	142,400,976 - 142,448,044 (+)	Ensembl

RefSeq Acc Id:

NM_001109209 ⟹ NP_001102679

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	162,883,736 - 162,908,207 (+)	NCBI
mRatBN7.2	3	142,423,571 - 142,448,044 (+)	NCBI
Rnor_6.0	3	149,424,392 - 149,449,350 (+)	NCBI
Rnor_5.0	3	155,802,169 - 155,827,127 (+)	NCBI
Celera	3	141,164,705 - 141,189,176 (+)	NCBI

Sequence:

show sequence

ATGTGGACTGCTTGGTGTGTGGCAGCTCTGTCAGTGGCAGCTGTGTGTGGCATCCGTCAAGACACAACCACAGTCCTCCGAGTTACAAAAGATGTGCTGGGCGATGCCATCTCAGGCACAATTCAGAA
GAGTGACGCCTTCCGCTCCGCCCTGAGGGAGGTGCCCGTGGGTGTCGGTGGTGTCCCCTACAACGACTTCCATGTCCGAGAGCCTCCCCCCAAATACACCAATGGCAGACAGCTTGGTGGCAATTACA
AATACGGTCACATTGAGGCGAATGACAACACAGCTCAGCTGGGGGGCAAATACCGCTATGGGGAGATCCTGGACTCTGATGGGAGCCTCAGGGACCTGCGGCACGAAGACTACCGTCCTTCAGACTCT
GCCTACCACCGCGGCCCCGGGAGGTACAGGTCTGCAGCGGACCCGTCCTCGGCGGGCAGGCTCCACCGGCGCGAACTGAGGCCTGGAGAGATCCCAGCTGGTGTGGCCACTGGAGCACTGGGCCCCGG
AGGCCTGCTGGGCACTGGGGGCATACTTGCAAACGAAGGCATTCTGGCAGGCCAAGGGGGCTTGCTTGGAGGAGGCGGTCTTCTTGGAGATGGAGGACTTCTCGGAGGAGGTGGTGTGCTCGGTGTGC
TGGGTGAAGGAGGTATCCTGAGCACCGTCCAAGGCATCACTGGGTTGCGCATCGTGGAACTTACCCTTCCCCGGGTGTCTGTGAGACTCCTGCCCGGTGTGGGTGTCTATCTGAGCTTGTACACTCGT
GTGGCCATCAATGGAAAGAGCCTCATTGGCTTCCTGGATATTGCAGTGGAGGTTAACATCACCGCCAAAGTTCGGCTGACCATGGACCGCACAGGCTACCCGCGGCTGGTCATTGAGCGCTGTGACAC
CCTCCTGGGAGGCATCAAAGTCAAGCTGCTTCGGGGGCTTCTCCCCAACCTGGTGGATAACTTAGTGAACCGAGTGCTGGCCAACGTACTCCCTGACCTGCTCTGTCCCATTGTGGATGTGGTTTTGG
GTCTTGTCAATGACCAGCTGGGTCTCGTGGACTCTTTGGTGCCTCTCGGAATACTTGGGAGTGTGCAATACACTTTCTCCAGCCTCCCACTGGTGACCGGGGAGTTCCTTGAGTTGGACCTTAATACT
CTAGTTGGGGAGGCAGGAGGTGACCTCATTGACTACCCCCTGGGCCGGCCAGCTATGTTGCCCAGGCCACAGATGCCAGAACTACCCCCCATGGGCGACAACACCAACTCCCAGCTGGCCATCTCGGC
CAATTTCCTGAGCTCGGTGCTGACCATGCTGCAGAAGCAAGGTGCATTGGACATAGACATCACTGATGGCATGTTTGAAGATCTCCCTCCACTTACCACTTCCACATTGGGGGCCTTGATTCCCAAGG
TGTTCCAGCAATACCCTGAGTCCCGCCCACTCACCATCAGGATCCAGGTGCCCAACCCCCCAACTGTGACCCTGCAGAAGGACAAGGCACTGGTGAAGGTGTTTGCCACCTCTGAAGTTGTCGTCTCC
CAGCCTAATGATGTGGAGACCACCATCTGCCTCATCGATGTGGACACAGACCTCTTGGCTTCATTTTCTGTGGAAGGGGATAAGCTCATGATCGATGCCAAGCTGGATAAGACCAGCCTCAACCTCAG
AACCTCAAACGTGGGCAACTTTGATGTGTTCATCTTGGAAATGTTGGTTGAGAAGATCTTTGACCTAGCGTTTATGCCCGCAATGAATGCTATACTGGGTTCTGGAGTCCCTCTGCCCAAAATCCTCA
ACATTGACTTCAGCAACGCCGACATCGACGTGTTGGAGGACCTTCTGGTGCTGAGCACATGAGTGACAGAGGTAGACAACGTGAGAAGAAGTCAACCAGCTTCAGGGAGGATTGTCCTGGACACCGGC
CTGGTCCCAAGTCTCTTCAGCCTTCACCACAGGTCCCCTCCCACCCTCCCACCCTTTCCTCCTCCTGCCCTCAGCCTGGGAAAGGATCCAGCCACTCCCCATTGGCCAACAATGCCATGCTCAGGACA
GCCTGGGGACTGAGATCTTGTGCTTTCAATAAAACATTTCACTTTCCCTGCA

hide sequence

RefSeq Acc Id:

XM_063284388 ⟹ XP_063140458

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	162,881,478 - 162,908,207 (+)	NCBI


Protein RefSeqs	NP_001102679	(Get FASTA)	NCBI Sequence Viewer
	XP_063140458	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL85983	(Get FASTA)	NCBI Sequence Viewer
	EDL85984	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000052216
GenBank Protein	Q05704	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001102679 ⟸ NM_001109209
- Peptide Label:	precursor
- UniProtKB:	Q05704 (UniProtKB/Swiss-Prot), A0A0H2UHZ5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MWTAWCVAALSVAAVCGIRQDTTTVLRVTKDVLGDAISGTIQKSDAFRSALREVPVGVGGVPYNDFHVREPPPKYTNGRQLGGNYKYGHIEANDNTAQLGGKYRYGEILDSDGSLRDLRHEDYRPSDS AYHRGPGRYRSAADPSSAGRLHRRELRPGEIPAGVATGALGPGGLLGTGGILANEGILAGQGGLLGGGGLLGDGGLLGGGGVLGVLGEGGILSTVQGITGLRIVELTLPRVSVRLLPGVGVYLSLYTR VAINGKSLIGFLDIAVEVNITAKVRLTMDRTGYPRLVIERCDTLLGGIKVKLLRGLLPNLVDNLVNRVLANVLPDLLCPIVDVVLGLVNDQLGLVDSLVPLGILGSVQYTFSSLPLVTGEFLELDLNT LVGEAGGDLIDYPLGRPAMLPRPQMPELPPMGDNTNSQLAISANFLSSVLTMLQKQGALDIDITDGMFEDLPPLTTSTLGALIPKVFQQYPESRPLTIRIQVPNPPTVTLQKDKALVKVFATSEVVVS QPNDVETTICLIDVDTDLLASFSVEGDKLMIDAKLDKTSLNLRTSNVGNFDVFILEMLVEKIFDLAFMPAMNAILGSGVPLPKILNIDFSNADIDVLEDLLVLST hide sequence

Ensembl Acc Id:

ENSRNOP00000047586 ⟸ ENSRNOT00000044574

Ensembl Acc Id:

ENSRNOP00000052216 ⟸ ENSRNOT00000055349

Ensembl Acc Id:

ENSRNOP00000093175 ⟸ ENSRNOT00000094034

RefSeq Acc Id:	XP_063140458 ⟸ XM_063284388
- Peptide Label:	isoform X1
- UniProtKB:	Q05704 (UniProtKB/Swiss-Prot), A0A0H2UHZ5 (UniProtKB/TrEMBL)

Protein Domains

Lipid-binding serum glycoprotein C-terminal Lipid-binding serum glycoprotein N-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q05704-F1-model_v2	AlphaFold	Q05704	1-617	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-47199	BioCyc
Ensembl Genes	ENSRNOG00000034174	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000055349	ENTREZGENE
Gene3D-CATH	Bactericidal permeability-increasing protein, domain 1	UniProtKB/Swiss-Prot
	Bactericidal permeability-increasing protein, domain 2	UniProtKB/Swiss-Prot
InterPro	Bactericidal_perm-incr_a/b_dom	UniProtKB/Swiss-Prot
	BPI_fold-BPI/LBP	UniProtKB/Swiss-Prot
	Lipid-bd_serum_glycop_C	UniProtKB/Swiss-Prot
	Lipid-bd_serum_glycop_N	UniProtKB/Swiss-Prot
KEGG Report	rno:499925	UniProtKB/Swiss-Prot
NCBI Gene	499925	ENTREZGENE
PANTHER	BPI FOLD-CONTAINING FAMILY B MEMBER 4	UniProtKB/Swiss-Prot
	BPI FOLD-CONTAINING FAMILY B MEMBER 4-RELATED	UniProtKB/Swiss-Prot
Pfam	LBP_BPI_CETP	UniProtKB/Swiss-Prot
	LBP_BPI_CETP_C	UniProtKB/Swiss-Prot
PhenoGen	Bpifb4	PhenoGen
RatGTEx	ENSRNOG00000034174	RatGTEx
SMART	BPI1	UniProtKB/Swiss-Prot
	BPI2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF55394	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHZ5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AJ34_RAT	UniProtKB/TrEMBL
	A0A8L2QMK3_RAT	UniProtKB/TrEMBL
	BPIB4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-01	Bpifb4	BPI fold containing family B, member 4	RY2G5	potential ligand-binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	RY2G5	potential ligand-binding protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar