Symbol:
Fgd1
Name:
FYVE, RhoGEF and PH domain containing 1
RGD ID:
1558012
MGI Page
MGI
Description:
Predicted to enable guanyl-nucleotide exchange factor activity and small GTPase binding activity. Involved in regulation of cell shape. Acts upstream of or within cytoskeleton organization. Located in Golgi apparatus; lamellipodium; and ruffle. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and limb. Human ortholog(s) of this gene implicated in X-linked Aarskog syndrome and non-syndromic X-linked intellectual disability. Orthologous to human FGD1 (FYVE, RhoGEF and PH domain containing 1).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
faciogenital dysplasia 1 protein homolog; faciogenital dysplasia homolog; FYVE, RhoGEF and PH domain-containing protein 1; rho/Rac GEF; rho/Rac guanine nucleotide exchange factor FGD1; ZFYVE; ZFYVE3; zinc finger FYVE domain-containing protein 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FGD1 (FYVE, RhoGEF and PH domain containing 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Fgd1 (FYVE, RhoGEF and PH domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fgd1 (FYVE, RhoGEF and PH domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FGD1 (FYVE, RhoGEF and PH domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FGD1 (FYVE, RhoGEF and PH domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fgd1 (FYVE, RhoGEF and PH domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FGD1 (FYVE, RhoGEF and PH domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FGD1 (FYVE, RhoGEF and PH domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fgd1 (FYVE, RhoGEF and PH domain containing 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FGD4 (FYVE, RhoGEF and PH domain containing 4) HGNC
OrthoMCL
Homo sapiens (human):
FGD2 (FYVE, RhoGEF and PH domain containing 2) HGNC
OrthoMCL
Homo sapiens (human):
FGD6 (FYVE, RhoGEF and PH domain containing 6) HGNC
Treefam
Alliance orthologs 3
Homo sapiens (human):
FGD1 (FYVE, RhoGEF and PH domain containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Fgd1 (FYVE, RhoGEF and PH domain containing 1)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fgd1 (FYVE, RhoGEF and PH domain containing 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
exc-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fgd1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 149,829,141 - 149,872,682 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 149,829,146 - 149,872,517 (+) Ensembl GRCm39 Ensembl GRCm38 X 151,046,141 - 151,089,686 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 151,046,150 - 151,089,521 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 147,481,776 - 147,523,642 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 146,387,949 - 146,429,815 (+) NCBI MGSCv36 mm8 MGSCv36 X 128,052,708 - 128,094,514 (+) NCBI MGSCv36 mm8 Celera X 133,315,143 - 133,357,665 (-) NCBI Celera Cytogenetic Map X F3 NCBI cM Map X 68.46 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Fgd1 Mouse Aarskog syndrome ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Aarskog disease | ClinVar Annotator: match by term: Aarskog syndrome ClinVar PMID:000740980|PMID:10930571|PMID:11093277|PMID:11940089|PMID:14560308|PMID:15809997|PMID:16353258|PMID:16688726|PMID:17152066|PMID:17847065|PMID:20082460|PMID:21739585|PMID:21965325|PMID:23211637|PMID:25046119|PMID:25741868|PMID:26029706|PMID:27959697|PMID:28492532|PMID:29276006|PMID:39033378|PMID:4146757|PMID:7954831 Fgd1 Mouse Atkin Syndrome ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Atkin Flaitz Patil Smith syndrome ClinVar PMID:26059843|PMID:28492532 Fgd1 Mouse autistic disorder ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Autism ClinVar PMID:21681106|PMID:30208311 Fgd1 Mouse Cornelia de Lange syndrome 2 ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Congenital muscular hypertrophy-cerebral syndrome ClinVar PMID:26386245|PMID:27334371|PMID:28166369|PMID:28492532|PMID:28548707|PMID:31334757|PMID:31602316 Fgd1 Mouse Diamond-Blackfan anemia 14 with mandibulofacial dysostosis ISO RGD:1351228 8554872 ClinVar Annotator: match by term: TSR2-related condition ClinVar PMID:24033266|PMID:28492532 Fgd1 Mouse genetic disease ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:000740980|PMID:11093277|PMID:11940089|PMID:14560308|PMID:17576681|PMID:17847065|PMID:19261807|PMID:19344873|PMID:20082460|PMID:21739585|PMID:21965325|PMID:23211637|PMID:23375260|PMID:24033266|PMID:25046119|PMID:25741868|PMID:26029706|PMID:26467025|PMID:27535533|PMID:27959697|PMID:28492532|PMID:7954831|PMID:8969170|PMID:9536098 Fgd1 Mouse intellectual disability ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Intellectual disability ClinVar PMID:11940089|PMID:21739585|PMID:23211637|PMID:25046119|PMID:25741868|PMID:26029706|PMID:28492532 Fgd1 Mouse non-syndromic X-linked intellectual disability 1 ISO RGD:1351228 8554872 ClinVar Annotator: match by term: INTELLECTUAL DEVELOPMENTAL DISORDER, X-LINKED 1 ClinVar PMID:26059843|PMID:28492532 Fgd1 Mouse syndromic X-linked intellectual disability Claes-Jensen type ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Intellectual developmental disorder, X-linked, syndromic 16 ClinVar PMID:25741868|PMID:28492532 Fgd1 Mouse syndromic X-linked intellectual disability Lubs type ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type ClinVar PMID:25741868 Fgd1 Mouse X-linked Aarskog syndrome ISO RGD:1351228 8554872 ClinVar Annotator: match by term: FGD1-Related Disorders ClinVar PMID:000740980|PMID:11940089|PMID:14560308|PMID:21739585|PMID:23211637|PMID:25046119|PMID:25741868|PMID:26029706|PMID:26467025|PMID:28492532|PMID:29276006|PMID:39033378|PMID:7954831 Fgd1 Mouse X-linked intellectual disability-psychosis-macroorchidism syndrome ISO RGD:1351228 8554872 ClinVar Annotator: match by term: Intellectual developmental disorder, X-linked, syndromic 16 ClinVar PMID:25741868|PMID:28492532
Only show annotations with direct experimental evidence (0 objects hidden)
Fgd1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FGD1 mRNA CTD PMID:36331819 Fgd1 Mouse 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fgd1 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of FGD1 mRNA CTD PMID:17942748 Fgd1 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FGD1 mRNA CTD PMID:17942748 Fgd1 Mouse 17beta-estradiol multiple interactions ISO RGD:1351228 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of FGD1 mRNA CTD PMID:20823114 Fgd1 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fgd1 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fgd1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FGD1 mRNA CTD PMID:17942748 Fgd1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1565188 6480464 Tetrachlorodibenzodioxin results in decreased expression of FGD1 mRNA CTD PMID:21215274 Fgd1 Mouse 2,4,4'-trichlorobiphenyl multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fgd1 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of FGD1 mRNA CTD PMID:20188158 Fgd1 Mouse aristolochic acid A increases expression ISO RGD:1351228 6480464 aristolochic acid I results in increased expression of FGD1 mRNA CTD PMID:33212167 Fgd1 Mouse benzo[a]pyrene affects methylation ISO RGD:1351228 6480464 Benzo(a)pyrene affects the methylation of FGD1 3' UTR; Benzo(a)pyrene affects the methylation of FGD1 exon; more ... CTD PMID:27901495|PMID:30157460 Fgd1 Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of FGD1 promoter CTD PMID:27312807 Fgd1 Mouse bucladesine multiple interactions ISO RGD:1351228 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of FGD1 mRNA CTD PMID:20823114 Fgd1 Mouse cadmium atom multiple interactions ISO RGD:1351228 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FGD1 more ... CTD PMID:35301059 Fgd1 Mouse cadmium dichloride multiple interactions ISO RGD:1351228 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FGD1 more ... CTD PMID:35301059 Fgd1 Mouse caffeine decreases phosphorylation ISO RGD:1351228 6480464 Caffeine results in decreased phosphorylation of FGD1 protein CTD PMID:35688186 Fgd1 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Fgd1 Mouse coumarin decreases phosphorylation ISO RGD:1351228 6480464 coumarin results in decreased phosphorylation of FGD1 protein CTD PMID:35688186 Fgd1 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Fgd1 Mouse FR900359 affects phosphorylation ISO RGD:1351228 6480464 FR900359 affects the phosphorylation of FGD1 protein CTD PMID:37730182 Fgd1 Mouse furan decreases expression ISO RGD:1565188 6480464 furan results in decreased expression of FGD1 mRNA CTD PMID:25539665 Fgd1 Mouse gentamycin decreases expression ISO RGD:1565188 6480464 Gentamicins results in decreased expression of FGD1 mRNA CTD PMID:33387578 Fgd1 Mouse indole-3-methanol affects expression ISO RGD:1565188 6480464 indole-3-carbinol affects the expression of FGD1 mRNA CTD PMID:21396975 Fgd1 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Fgd1 Mouse leflunomide decreases expression ISO RGD:1351228 6480464 leflunomide results in decreased expression of FGD1 mRNA CTD PMID:28988120 Fgd1 Mouse medroxyprogesterone acetate multiple interactions ISO RGD:1351228 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of FGD1 mRNA CTD PMID:20823114 Fgd1 Mouse niclosamide increases expression ISO RGD:1351228 6480464 Niclosamide results in increased expression of FGD1 mRNA CTD PMID:36318118 Fgd1 Mouse ochratoxin A increases expression ISO RGD:1565188 6480464 ochratoxin A results in increased expression of FGD1 mRNA CTD PMID:17483316 Fgd1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Fgd1 Mouse paracetamol decreases expression ISO RGD:1565188 6480464 Acetaminophen results in decreased expression of FGD1 mRNA CTD PMID:33387578 Fgd1 Mouse PCB138 multiple interactions EXP 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Fgd1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FGD1 mRNA CTD PMID:36331819 Fgd1 Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of FGD1 mRNA CTD PMID:19482888 Fgd1 Mouse phenobarbital multiple interactions EXP 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of FGD1 mRNA] CTD PMID:19482888 Fgd1 Mouse sodium arsenite increases expression ISO RGD:1351228 6480464 sodium arsenite results in increased expression of FGD1 mRNA CTD PMID:38568856 Fgd1 Mouse sunitinib decreases expression ISO RGD:1351228 6480464 Sunitinib results in decreased expression of FGD1 mRNA CTD PMID:31533062 Fgd1 Mouse testosterone affects expression EXP 6480464 Testosterone affects the expression of FGD1 mRNA CTD PMID:20403060 Fgd1 Mouse thioacetamide decreases expression ISO RGD:1565188 6480464 Thioacetamide results in decreased expression of FGD1 mRNA CTD PMID:34492290 Fgd1 Mouse thiram increases expression ISO RGD:1351228 6480464 Thiram results in increased expression of FGD1 mRNA CTD PMID:38568856 Fgd1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of FGD1 promoter CTD PMID:35295148 Fgd1 Mouse topotecan affects response to substance ISO RGD:1351228 6480464 FGD1 protein affects the susceptibility to Topotecan CTD PMID:16217747 Fgd1 Mouse triphenyl phosphate affects expression ISO RGD:1351228 6480464 triphenyl phosphate affects the expression of FGD1 mRNA CTD PMID:37042841 Fgd1 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of FGD1 mRNA CTD PMID:33045310 Fgd1 Mouse vorinostat decreases expression ISO RGD:1351228 6480464 vorinostat results in decreased expression of FGD1 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (EXP) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (EXP) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) bucladesine (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) choline (EXP) coumarin (ISO) folic acid (EXP) FR900359 (ISO) furan (ISO) gentamycin (ISO) indole-3-methanol (ISO) L-methionine (EXP) leflunomide (ISO) medroxyprogesterone acetate (ISO) niclosamide (ISO) ochratoxin A (ISO) ozone (EXP) paracetamol (ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) sodium arsenite (ISO) sunitinib (ISO) testosterone (EXP) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) topotecan (ISO) triphenyl phosphate (ISO) triptonide (EXP) vorinostat (ISO)
1.
Novel FGD1 mutation underlying Aarskog-Scott syndrome with myopathy and distal arthropathy.
Al-Semari A, etal., Clin Dysmorphol. 2013 Jan;22(1):13-7. doi: 10.1097/MCD.0b013e32835b6dc4.
2.
Faciogenital dysplasia protein Fgd1 regulates invadopodia biogenesis and extracellular matrix degradation and is up-regulated in prostate and breast cancer.
Ayala I, etal., Cancer Res. 2009 Feb 1;69(3):747-52. doi: 10.1158/0008-5472.CAN-08-1980. Epub 2009 Jan 13.
3.
Non-syndromic X-linked mental retardation associated with a missense mutation (P312L) in the FGD1 gene.
Lebel RR, etal., Clin Genet. 2002 Feb;61(2):139-45.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
Aarskog-Scott syndrome: clinical update and report of nine novel mutations of the FGD1 gene.
Orrico A, etal., Am J Med Genet A. 2010 Feb;152A(2):313-8. doi: 10.1002/ajmg.a.33199.
7.
Isolation and characterization of the faciogenital dysplasia (Aarskog-Scott syndrome) gene: a putative Rho/Rac guanine nucleotide exchange factor.
Pasteris NG, etal., Cell. 1994 Nov 18;79(4):669-78.
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Clinical variation of Aarskog syndrome in a large family with 2189delA in the FGD1 gene.
Shalev SA, etal., Am J Med Genet A. 2006 Jan 15;140(2):162-5.
Fgd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 149,829,141 - 149,872,682 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 149,829,146 - 149,872,517 (+) Ensembl GRCm39 Ensembl GRCm38 X 151,046,141 - 151,089,686 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 151,046,150 - 151,089,521 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 147,481,776 - 147,523,642 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 146,387,949 - 146,429,815 (+) NCBI MGSCv36 mm8 MGSCv36 X 128,052,708 - 128,094,514 (+) NCBI MGSCv36 mm8 Celera X 133,315,143 - 133,357,665 (-) NCBI Celera Cytogenetic Map X F3 NCBI cM Map X 68.46 NCBI
FGD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 54,445,454 - 54,496,234 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 54,445,454 - 54,496,234 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 54,471,887 - 54,522,667 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 54,488,612 - 54,539,324 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 54,354,909 - 54,405,620 NCBI Celera X 58,304,448 - 58,355,160 (-) NCBI Celera Cytogenetic Map X p11.22 NCBI HuRef X 51,522,464 - 51,572,796 (-) NCBI HuRef CHM1_1 X 54,462,541 - 54,513,238 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 53,736,310 - 53,787,092 (-) NCBI T2T-CHM13v2.0
Fgd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 23,466,791 - 23,509,773 (+) NCBI GRCr8 mRatBN7.2 X 20,023,746 - 20,066,734 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 20,023,746 - 20,066,566 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 17,462,039 - 17,504,869 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 22,618,713 - 22,661,545 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 20,552,995 - 20,595,814 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 20,100,942 - 20,143,871 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 20,100,942 - 20,143,871 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 20,216,587 - 20,225,955 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 20,846,380 - 20,888,661 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 40,364,211 - 40,407,213 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 20,281,249 - 20,323,819 (+) NCBI Celera Cytogenetic Map X q12 NCBI
Fgd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955475 1,703,374 - 1,752,710 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955475 1,703,374 - 1,752,710 (-) NCBI ChiLan1.0 ChiLan1.0
FGD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 55,834,119 - 55,884,005 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 55,837,723 - 55,887,601 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 46,648,765 - 46,699,444 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 54,880,751 - 54,930,672 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 54,880,513 - 54,930,672 (-) Ensembl panpan1.1 panPan2
FGD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 46,194,950 - 46,239,291 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 46,194,735 - 46,270,701 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 37,583,900 - 37,627,968 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 46,516,320 - 46,560,389 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 46,516,275 - 46,560,769 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 46,014,132 - 46,058,399 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 46,464,507 - 46,508,560 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 46,531,810 - 46,575,872 (-) NCBI UU_Cfam_GSD_1.0
Fgd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 39,012,340 - 39,057,557 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936751 1,351,795 - 1,397,288 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936751 1,355,606 - 1,397,282 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FGD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 47,192,427 - 47,231,342 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 47,191,838 - 47,231,656 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 53,049,149 - 53,088,229 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FGD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 50,554,648 - 50,609,437 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 50,556,168 - 50,583,010 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666086 4,520,644 - 4,572,317 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fgd1
.
Predicted Target Of
Count of predictions: 1172 Count of miRNA genes: 478 Interacting mature miRNAs: 557 Transcripts: ENSMUST00000026296, ENSMUST00000112685, ENSMUST00000124882, ENSMUST00000125620 Prediction methods: Miranda, Pita, Pita,Targetscan, Rnahybrid, Targetscan Result types: miRGate_prediction
10401118 Pgia39_m proteoglycan induced arthritis 39 (mouse) Not determined X 144474380 169476592 Mouse 1558900 Bw3_m body weight QTL 3 (mouse) Not determined X 133540040 165298595 Mouse 1302000 Pgia25_m proteoglycan induced arthritis 2 (mouse) Not determined X 144474380 169476592 Mouse 25314309 Syncl5_m synaptonemal complex length 5 (mouse) X 121909697 152582996 Mouse 13824981 Svwq2_m seminal vesicle weight QTL 2 (mouse) X 128900749 153782996 Mouse 12738421 Lfibq17_m liver fibrosis QTL 17 (mouse) X 148148453 164945064 Mouse 1301209 Cia19_m collagen induced arthritis 19 (mouse) Not determined X 120993165 160213038 Mouse 10412164 Cmv2_m cytomegalovirus resistance 2 (mouse) Not determined X 125685149 159685269 Mouse 1357823 Spha3_m sperm head anomaly 3 (mouse) Not determined X 102055848 162758941 Mouse 1357433 Dbts2_m diabetes 2 (mouse) Not determined X 7226295 150107038 Mouse 1301276 Tswt_m testis weight (mouse) Not determined X 138376411 150789338 Mouse
DXMit153
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 151,055,859 - 151,056,001 UniSTS GRCm38 MGSCv37 X 147,490,402 - 147,490,544 UniSTS GRCm37 Cytogenetic Map X F3 UniSTS cM Map X 62.2 UniSTS Whitehead Genetic X 50.3 UniSTS Whitehead_YAC X UniSTS
px-2c2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 151,076,357 - 151,076,709 UniSTS GRCm38 MGSCv37 X 147,510,900 - 147,511,252 UniSTS GRCm37 Celera X 133,327,490 - 133,327,836 UniSTS Cytogenetic Map X F3 UniSTS cM Map X 64.0 UniSTS
Fgd1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 151,088,714 - 151,088,880 UniSTS GRCm38 MGSCv37 X 147,523,257 - 147,523,423 UniSTS GRCm37 Celera X 133,315,360 - 133,315,526 UniSTS Cytogenetic Map X F3 UniSTS cM Map X 64.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000026296 ⟹ ENSMUSP00000026296
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 149,830,166 - 149,872,517 (+) Ensembl GRCm38.p6 Ensembl X 151,047,170 - 151,089,521 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112685 ⟹ ENSMUSP00000108305
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 149,829,146 - 149,872,517 (+) Ensembl GRCm38.p6 Ensembl X 151,046,150 - 151,089,521 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000124882
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 149,850,379 - 149,852,664 (+) Ensembl GRCm38.p6 Ensembl X 151,067,383 - 151,069,668 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000125620
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 149,869,106 - 149,870,177 (+) Ensembl GRCm38.p6 Ensembl X 151,086,110 - 151,087,181 (+) Ensembl
RefSeq Acc Id:
NM_008001 ⟹ NP_032027
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 149,830,166 - 149,872,682 (+) NCBI GRCm38 X 151,047,170 - 151,089,686 (+) NCBI MGSCv37 X 147,481,776 - 147,523,642 (+) RGD Celera X 133,314,554 - 133,357,728 (-) NCBI cM Map X ENTREZGENE
Sequence:
TCCGCCCCCAGCCTCCGCTGCGGCGGGAGGAAGAACCCTTCCCGACTAGCCCAGAGAACCCAGGTCGATTCTCATTCCGGGAGAAAGAGACCCCCCTCGGTGGGATCCGGCTGGCCGCTCGCCCCCGG
hide sequence
RefSeq Acc Id:
XM_006528699 ⟹ XP_006528762
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 149,829,141 - 149,872,528 (+) NCBI GRCm38 X 151,046,141 - 151,089,685 (+) NCBI
Sequence:
GAGGTCTGTTGCTAAGAATTCCAGACCTTTCTTCTGGCGTCTTCTGTTCACTCCATGACTGCACCAGGGAAACCGGATCCTGGTTAAAAGTTTGTCCCTTGACCCTGGCCAGAGCCTTGAGCCTCATC
hide sequence
RefSeq Acc Id:
XR_004940326
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 149,829,735 - 149,872,517 (+) NCBI
Sequence:
CTCGCCTCTGTGGGACCAAGGAAGGATGGGAAGGAAAGCTGAAGGGCCAGCAGAAGGAGGGCCT
hide sequence
RefSeq Acc Id:
NP_032027 ⟸ NM_008001
- UniProtKB:
Q921L2 (UniProtKB/Swiss-Prot), P52734 (UniProtKB/Swiss-Prot), Q3UG32 (UniProtKB/TrEMBL)
- Sequence:
MHGHRVPGGPGPSDPERSAANTPGAAPLACADSDPGALEPGLPVSRGSGTALGGPLDPQFVGPSDASLGAPPSSRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPGQSLEPHPE
hide sequence
RefSeq Acc Id:
XP_006528762 ⟸ XM_006528699
- Peptide Label:
isoform X1
- UniProtKB:
A2ALP5 (UniProtKB/TrEMBL), Q3UG32 (UniProtKB/TrEMBL)
- Sequence:
MPRVLPPPEPIPPPPSRPLPADPRVAKGLVPRAEASTSSAAVSSLIEKFEREPVIVASDRPAPG
hide sequence
Ensembl Acc Id:
ENSMUSP00000026296 ⟸ ENSMUST00000026296
Ensembl Acc Id:
ENSMUSP00000108305 ⟸ ENSMUST00000112685
RGD ID: 6845697 Promoter ID: MM_KWN:62326 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, Brain, ES_Cell, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000101166, OTTMUST00000046115 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 147,481,201 - 147,482,422 (+) MPROMDB
RGD ID: 6845700 Promoter ID: MM_KWN:62327 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000046117 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 147,500,951 - 147,501,451 (+) MPROMDB
RGD ID: 6845701 Promoter ID: MM_KWN:62328 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney, MEF_B6 Transcripts: OTTMUST00000046118 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 147,520,061 - 147,521,002 (+) MPROMDB
RGD ID: 13681618 Promoter ID: EPDNEW_M24958 Type: initiation region Name: Fgd1_1 Description: Mus musculus FYVE, RhoGEF and PH domain containing 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 X 151,047,201 - 151,047,261 EPDNEW
