Symbol:
Papolg
Name:
poly(A) polymerase gamma
RGD ID:
1553464
MGI Page
MGI
Description:
Predicted to enable metal ion binding activity and poly(A) RNA polymerase activity. Predicted to be involved in RNA 3'-end processing and mRNA processing. Predicted to be located in cytosol and nuclear body. Predicted to be active in nucleus. Orthologous to human PAPOLG (poly(A) polymerase gamma).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
9630006B20Rik; PAP-gamma; polynucleotide adenylyltransferase gamma; RP23-42P24.1; signal recognition particle RNA-adenylating enzyme; SRP 3'-adenylating protein; SRP RNA 3'-adenylating enzyme; SRP RNA-adenylating enzyme
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PAPOLG (poly(A) polymerase gamma) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Papolg (poly(A) polymerase gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Papolg (poly(A) polymerase gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PAPOLG (poly(A) polymerase gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PAPOLG (poly(A) polymerase gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Papolg (poly(A) polymerase gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PAPOLG (poly(A) polymerase gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PAPOLG (poly(A) polymerase gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Papolg (poly(A) polymerase gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PAPOLA (poly(A) polymerase alpha) HGNC
OrthoMCL
Homo sapiens (human):
PAPOLB (poly(A) polymerase beta) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Papolg (poly(A) polymerase gamma)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PAPOLG (poly(A) polymerase gamma)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
papolg (poly(A) polymerase gamma)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
F43G6.5
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PAP1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
hrg
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T15H9.6
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pap-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
papolg
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 23,810,145 - 23,845,292 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 23,812,646 - 23,845,253 (-) Ensembl GRCm39 Ensembl GRCm38 11 23,860,145 - 23,895,293 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 23,862,646 - 23,895,253 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 23,762,646 - 23,795,270 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 23,762,665 - 23,795,253 (-) NCBI MGSCv36 mm8 Celera 11 25,984,007 - 26,016,631 (-) NCBI Celera Cytogenetic Map 11 A3.2 NCBI cM Map 11 14.37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Papolg Mouse (-)-epigallocatechin 3-gallate increases expression ISO RGD:1321183 6480464 epigallocatechin gallate results in increased expression of PAPOLG mRNA CTD PMID:35701726 Papolg Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PAPOLG mRNA CTD PMID:22206623 Papolg Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of PAPOLG mRNA CTD PMID:22206623 Papolg Mouse 2,3',4,4',5-Pentachlorobiphenyl decreases expression EXP 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of PAPOLG mRNA CTD PMID:31388691 Papolg Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PAPOLG mRNA CTD PMID:21570461 Papolg Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1321183 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Papolg Mouse amitrole decreases expression ISO RGD:1310337 6480464 Amitrole results in decreased expression of PAPOLG mRNA CTD PMID:38685447 Papolg Mouse arsane multiple interactions ISO RGD:1321183 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Papolg Mouse arsenic atom multiple interactions ISO RGD:1321183 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Papolg Mouse arsenite(3-) multiple interactions ISO RGD:1321183 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PAPOLG mRNA] CTD PMID:32406909 Papolg Mouse atrazine affects methylation ISO RGD:1310337 6480464 Atrazine affects the methylation of PAPOLG gene CTD PMID:35440735 Papolg Mouse benzo[a]pyrene increases methylation ISO RGD:1321183 6480464 Benzo(a)pyrene results in increased methylation of PAPOLG promoter CTD PMID:27901495 Papolg Mouse beta-lapachone decreases expression ISO RGD:1321183 6480464 beta-lapachone results in decreased expression of PAPOLG mRNA CTD PMID:38218311 Papolg Mouse bisphenol A increases expression ISO RGD:1310337 6480464 bisphenol A results in increased expression of PAPOLG mRNA CTD PMID:25181051|PMID:30816183 Papolg Mouse bisphenol A multiple interactions ISO RGD:1321183 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Papolg Mouse bisphenol F multiple interactions ISO RGD:1321183 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Papolg Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of PAPOLG mRNA CTD PMID:38685157 Papolg Mouse C60 fullerene decreases expression ISO RGD:1310337 6480464 fullerene C60 results in decreased expression of PAPOLG mRNA CTD PMID:19167457 Papolg Mouse caffeine affects phosphorylation ISO RGD:1321183 6480464 Caffeine affects the phosphorylation of PAPOLG protein CTD PMID:35688186 Papolg Mouse dexamethasone multiple interactions ISO RGD:1321183 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Papolg Mouse diazinon increases methylation ISO RGD:1321183 6480464 Diazinon results in increased methylation of PAPOLG gene CTD PMID:22964155 Papolg Mouse disodium selenite increases expression ISO RGD:1321183 6480464 Sodium Selenite results in increased expression of PAPOLG mRNA CTD PMID:18175754 Papolg Mouse dorsomorphin multiple interactions ISO RGD:1321183 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Papolg Mouse doxorubicin decreases expression ISO RGD:1321183 6480464 Doxorubicin results in decreased expression of PAPOLG mRNA CTD PMID:29803840 Papolg Mouse folic acid multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PAPOLG mRNA CTD PMID:22206623 Papolg Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of PAPOLG mRNA CTD PMID:25629700 Papolg Mouse formaldehyde decreases expression ISO RGD:1321183 6480464 Formaldehyde results in decreased expression of PAPOLG mRNA CTD PMID:20655997 Papolg Mouse FR900359 increases phosphorylation ISO RGD:1321183 6480464 FR900359 results in increased phosphorylation of PAPOLG protein CTD PMID:37730182 Papolg Mouse indometacin multiple interactions ISO RGD:1321183 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Papolg Mouse ketoconazole increases expression ISO RGD:1321183 6480464 Ketoconazole results in increased expression of PAPOLG mRNA CTD PMID:36621641 Papolg Mouse leflunomide increases expression ISO RGD:1321183 6480464 leflunomide results in increased expression of PAPOLG mRNA CTD PMID:28988120 Papolg Mouse manganese atom multiple interactions ISO RGD:1321183 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Papolg Mouse manganese(0) multiple interactions ISO RGD:1321183 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Papolg Mouse manganese(II) chloride multiple interactions ISO RGD:1321183 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Papolg Mouse methyl methanesulfonate increases expression ISO RGD:1321183 6480464 Methyl Methanesulfonate results in increased expression of PAPOLG mRNA CTD PMID:23649840 Papolg Mouse phenobarbital affects expression ISO RGD:1321183 6480464 Phenobarbital affects the expression of PAPOLG mRNA CTD PMID:19159669 Papolg Mouse phenylmercury acetate decreases expression ISO RGD:1321183 6480464 Phenylmercuric Acetate results in decreased expression of PAPOLG mRNA CTD PMID:26272509 Papolg Mouse phenylmercury acetate multiple interactions ISO RGD:1321183 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Papolg Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Papolg Mouse SB 431542 multiple interactions ISO RGD:1321183 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Papolg Mouse silicon dioxide increases expression ISO RGD:1321183 6480464 Silicon Dioxide results in increased expression of PAPOLG mRNA CTD PMID:25351596 Papolg Mouse sodium arsenite multiple interactions ISO RGD:1321183 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Papolg Mouse sodium arsenite decreases expression ISO RGD:1321183 6480464 sodium arsenite results in decreased expression of PAPOLG protein CTD PMID:30528433 Papolg Mouse Soman decreases expression ISO RGD:1310337 6480464 Soman results in decreased expression of PAPOLG mRNA CTD PMID:19281266 Papolg Mouse testosterone decreases expression ISO RGD:1321183 6480464 Testosterone results in decreased expression of PAPOLG mRNA CTD PMID:33359661 Papolg Mouse thioacetamide increases expression ISO RGD:1310337 6480464 Thioacetamide results in increased expression of PAPOLG mRNA CTD PMID:34492290 Papolg Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of PAPOLG mRNA CTD PMID:29264374 Papolg Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PAPOLG gene CTD PMID:35295148 Papolg Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of PAPOLG promoter CTD PMID:35295148 Papolg Mouse torcetrapib increases expression ISO RGD:1321183 6480464 torcetrapib results in increased expression of PAPOLG mRNA CTD PMID:23228038 Papolg Mouse trichostatin A decreases expression ISO RGD:1321183 6480464 trichostatin A results in decreased expression of PAPOLG mRNA CTD PMID:24935251 Papolg Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of PAPOLG mRNA CTD PMID:33045310 Papolg Mouse urethane increases expression ISO RGD:1321183 6480464 Urethane results in increased expression of PAPOLG mRNA CTD PMID:28818685 Papolg Mouse valproic acid affects expression ISO RGD:1321183 6480464 Valproic Acid affects the expression of PAPOLG mRNA CTD PMID:25979313 Papolg Mouse valproic acid decreases expression ISO RGD:1321183 6480464 Valproic Acid results in decreased expression of PAPOLG mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:25192806|PMID:26272509|PMID:27188386|PMID:28001369 Papolg Mouse valproic acid multiple interactions ISO RGD:1321183 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Papolg Mouse vinclozolin increases expression ISO RGD:1310337 6480464 vinclozolin results in increased expression of PAPOLG mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
Papolg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 23,810,145 - 23,845,292 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 23,812,646 - 23,845,253 (-) Ensembl GRCm39 Ensembl GRCm38 11 23,860,145 - 23,895,293 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 23,862,646 - 23,895,253 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 23,762,646 - 23,795,270 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 23,762,665 - 23,795,253 (-) NCBI MGSCv36 mm8 Celera 11 25,984,007 - 26,016,631 (-) NCBI Celera Cytogenetic Map 11 A3.2 NCBI cM Map 11 14.37 NCBI
PAPOLG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 60,756,268 - 60,802,086 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 60,756,253 - 60,802,086 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 60,983,403 - 61,029,221 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 60,836,887 - 60,879,602 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 60,895,033 - 60,937,747 NCBI Celera 2 60,826,967 - 60,872,820 (+) NCBI Celera Cytogenetic Map 2 p16.1 NCBI HuRef 2 60,725,544 - 60,771,413 (+) NCBI HuRef CHM1_1 2 60,913,785 - 60,959,664 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 60,762,056 - 60,807,916 (+) NCBI T2T-CHM13v2.0
Papolg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 102,028,842 - 102,062,155 (-) NCBI GRCr8 mRatBN7.2 14 97,827,712 - 97,861,024 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 97,827,712 - 97,861,024 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 102,153,429 - 102,186,565 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 103,397,660 - 103,430,794 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 99,869,339 - 99,902,473 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 108,624,359 - 108,658,371 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 108,624,359 - 108,658,371 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 108,346,030 - 108,380,042 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 104,800,058 - 104,833,509 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 104,819,267 - 104,852,722 (-) NCBI Celera 14 96,796,350 - 96,827,229 (-) NCBI Celera Cytogenetic Map 14 q22 NCBI
Papolg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 23,003,107 - 23,034,412 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 23,005,942 - 23,034,360 (-) NCBI ChiLan1.0 ChiLan1.0
PAPOLG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 65,571,229 - 65,622,291 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 65,583,940 - 65,626,242 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 60,846,593 - 60,892,462 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 61,988,572 - 62,030,291 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 61,988,572 - 62,030,291 (+) Ensembl panpan1.1 panPan2
PAPOLG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 60,879,161 - 60,910,417 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 60,879,037 - 60,907,498 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 60,767,357 - 60,797,232 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 61,885,805 - 61,915,710 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 61,885,804 - 61,917,460 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 61,585,901 - 61,615,753 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 61,873,384 - 61,903,454 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 62,165,588 - 62,195,664 (+) NCBI UU_Cfam_GSD_1.0
Papolg Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 22,250,508 - 22,286,097 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 6,285,206 - 6,322,668 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 6,285,209 - 6,320,646 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PAPOLG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 80,986,402 - 81,025,293 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 80,986,395 - 81,025,369 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 85,081,488 - 85,116,907 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PAPOLG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 46,193,350 - 46,237,078 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 46,189,698 - 46,237,059 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 65,563,753 - 65,610,061 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Papolg
.
Predicted Target Of
Count of predictions: 1162 Count of miRNA genes: 566 Interacting mature miRNAs: 730 Transcripts: ENSMUST00000020513, ENSMUST00000102863, ENSMUST00000145013, ENSMUST00000150711 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1302171 Pgia28_m proteoglycan induced arthritis 28 (mouse) Not determined 11 8906097 42906218 Mouse 1357720 Kidpq1_m kidney weight percentage QTL 1 (mouse) Not determined 11 12268637 68500330 Mouse 1357722 Vtbt11_m vertebral trabecular bone trait 11 (mouse) Not determined 11 1 23880487 Mouse 1357851 Scfq3_m subcutaneous fat pad weight QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 27226762 Feml21_m femur length 21, 16 week (mouse) 11 11750000 65990826 Mouse 1301765 Skull15_m skull morphology 15 (mouse) Not determined 11 1 25976374 Mouse 4141470 Egq4_m early growth QTL 4 (mouse) Not determined 12268637 68500330 Mouse 13524844 Ppiq9_m prepulse inhibition QTL 9 (mouse) 11 9049997 35077325 Mouse 4142109 W10q2_m weight 10 weeks QTL 2 (mouse) Not determined 12268637 68500330 Mouse 1300661 Lmr6_m leishmaniasis resistance 6 (mouse) Not determined 11 1 25976374 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 10412216 Eae44_m experimental allergic encephalomyelitis susceptibility 44 (mouse) Not determined 11 12268637 39950840 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 26884401 Huml4_m humerus length 4, 10 week (mouse) 11 11550000 68490826 Mouse 10053687 Eae6_m susceptibility to experimental allergic encephalomyelitis 6 (mouse) Not determined 11 17781966 68500330 Mouse 27226798 Scvln18_m sacral vertebrae length 2, 16 week (mouse) 11 3250000 60690826 Mouse 4141582 Lgaq1_m late growth adjusted QTL 1 (mouse) Not determined 12268637 68500330 Mouse 4141966 Tailq1_m tail length QTL 1 (mouse) Not determined 12268637 68500330 Mouse 1300768 Tshp9_m tooth shape 9 (mouse) Not determined 11 1 25976374 Mouse 1558945 Orgwq8_m organ weight QTL 8 (mouse) Not determined 11 17056175 67078411 Mouse 4142216 Lgq1_m late growth QTL 1 (mouse) Not determined 12268637 68500330 Mouse 1300905 Scc6_m colon tumor susceptibility 6 (mouse) Not determined 11 6880277 89019734 Mouse 14746971 Manh70_m mandible shape 70 (mouse) 11 19905890 53905890 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 26884446 Sklq10_m skull length QTL 10, 10 week (mouse) 11 3250000 62890826 Mouse 4141047 Nilac1_m nicotine induced locomotor activity 1 (mouse) Not determined 11 9011780 43011942 Mouse 10412246 Dfs2_m dental fluorosis suseptibility 2 (mouse) Not determined 11 21807364 95881231 Mouse 1559002 Lmrq4_m Leishmania major resistance QTL 4 (mouse) Not determined 11 12268637 69684947 Mouse 1300938 Bulb3_m bulb size 3 (mouse) Not determined 11 18578616 52578716 Mouse 1357518 Tgyl1_m triglyceride level 1 (mouse) Not determined 11 6880277 33916219 Mouse 4142308 W6q3_m weight 6 weeks QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 1357640 Orq2_m ovulation rate QTL 2 (mouse) Not determined 11 12268637 68500330 Mouse 1300599 Cocrb11_m cocaine related behavior 11 (mouse) Not determined 11 2670355 36671472 Mouse 1357437 Epfq4_m epididymal fat pad weight QTL 4 (mouse) Not determined 11 12268637 68500330 Mouse 4141398 Tgq22_m triglyceride QTL 22 (mouse) Not determined 21163406 55163406 Mouse 27226741 Metcl5_m metatarsal-calcaneal length 5, 5 week (mouse) 11 4650000 46290827 Mouse 1300990 Bits3_m bitterness sensitivity 3 (mouse) Not determined 11 8372121 42372260 Mouse 27226738 Metcl11_m metatarsal-calcaneal length 11, 10 week (mouse) 11 8850000 61390826 Mouse 27226735 Metcl16_m metatarsal-calcaneal length 16, 16 week (mouse) 11 5250000 35090827 Mouse 12801459 Leuf1_m leukocyte filtration 1 (mouse) 11 18578616 52578716 Mouse 1300579 Thypr1_m thymocyte proliferative response 1 (mouse) Not determined 11 19282577 53282715 Mouse 10044008 Hbnr15_m Heligmosomoides bakeri nematode resistance 15 (mouse) Not determined 11 227052 34227232 Mouse 12801457 Intmrm2_m intima/media ratio modifier 2 (mouse) 11 18578616 52578716 Mouse 12801460 Intim2_m intima modifier 2 (mouse) 11 18578616 52578716 Mouse 27095909 Scvln6_m sacral vertebrae length 2, 5 week (mouse) 11 3250000 44090827 Mouse 4141127 W3q4_m weight 3 weeks QTL 4 (mouse) Not determined 12268637 68500330 Mouse 4141894 Nidd6k_m Nidd6 on KK-A (mouse) Not determined 19124204 96897826 Mouse 13463479 Mchq19_m mean corpuscular hemoglobin QTL 19 (mouse) 11 10951232 44951464 Mouse 27095904 Scvln12_m sacral vertebrae length 2, 10 week (mouse) 11 3250000 34495048 Mouse 13463472 Mcvq15_m mean corpuscular volume QTL 15 (mouse) 11 10951232 44951464 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse
UniSTS:236534
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 23,862,992 - 23,863,244 UniSTS GRCm38 MGSCv37 11 23,762,992 - 23,763,244 UniSTS GRCm37 Celera 11 25,984,353 - 25,984,605 UniSTS Cytogenetic Map 11 A3.2 UniSTS
px-38e3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 18 D3 UniSTS Cytogenetic Map 5 B3 UniSTS Cytogenetic Map 17 B3 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 13 C1 UniSTS Cytogenetic Map 16 B5 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 1 H4 UniSTS Cytogenetic Map 7 F2 UniSTS Cytogenetic Map 10 D2 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map Y A1 UniSTS Cytogenetic Map 11 A3.2 UniSTS Cytogenetic Map 3 A1 UniSTS Cytogenetic Map 13 C3 UniSTS Cytogenetic Map 1 H6 UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 10 D1 UniSTS Cytogenetic Map 10 A1 UniSTS cM Map 10 60.0 UniSTS cM Map 1 106.6 UniSTS cM Map 19 36.5 UniSTS cM Map 5 20.0 UniSTS cM Map 13 40.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000020513 ⟹ ENSMUSP00000020513
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,812,646 - 23,845,253 (-) Ensembl GRCm38.p6 Ensembl 11 23,862,646 - 23,895,253 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000102863 ⟹ ENSMUSP00000099927
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,820,056 - 23,845,236 (-) Ensembl GRCm38.p6 Ensembl 11 23,870,056 - 23,895,236 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000145013 ⟹ ENSMUSP00000115518
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,815,244 - 23,818,470 (-) Ensembl GRCm38.p6 Ensembl 11 23,865,244 - 23,868,470 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000150711
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 23,816,411 - 23,841,904 (-) Ensembl GRCm38.p6 Ensembl 11 23,866,411 - 23,891,904 (-) Ensembl
RefSeq Acc Id:
NM_172555 ⟹ NP_766143
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,812,646 - 23,845,270 (-) NCBI GRCm38 11 23,862,646 - 23,895,270 (-) NCBI MGSCv37 11 23,762,646 - 23,795,270 (-) RGD Celera 11 25,984,007 - 26,016,631 (-) RGD cM Map 11 ENTREZGENE
Sequence:
AGGCGAGAGGCAGCCTGGGAAGTAGCGCCATATTGGCGGTGGCCGCGCTGTATTGTCATAAATAGAGCCGGTTTTGTGGTGTTTTCACTACTCGGTTGAATGCCTCGGCTGTAGAGAGTGGGGAAGTG
hide sequence
RefSeq Acc Id:
XM_006514653 ⟹ XP_006514716
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,810,145 - 23,845,283 (-) NCBI GRCm38 11 23,860,145 - 23,895,293 (-) NCBI
Sequence:
GCGGAGCCGCGGAAGGCGAGAGGCAGCCTGGGAAGTAGCGCCATATTGGCGGTGGCCGCGCTGT
hide sequence
RefSeq Acc Id:
XR_380964
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 23,810,145 - 23,845,292 (-) NCBI GRCm38 11 23,860,145 - 23,895,292 (-) NCBI
Sequence:
GGCTGCAGGGCGGAGCCGCGGAAGGCGAGAGGCAGCCTGGGAAGTAGCGCCATATTGGCGGTGGCCGCGCTGTATTGTCATAAATAGAGCCGGTTTTGTGGTGTTTTCACTACTCGGTTGAATGCCTC
hide sequence
RefSeq Acc Id:
NP_766143 ⟸ NM_172555
- UniProtKB:
Q8BZC9 (UniProtKB/Swiss-Prot), Q6PCL9 (UniProtKB/Swiss-Prot)
- Sequence:
MKEMSANTMLDSQRQQKHYGITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDISESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDF
hide sequence
RefSeq Acc Id:
XP_006514716 ⟸ XM_006514653
- Peptide Label:
isoform X1
- Sequence:
MLDSQRQQKHYGITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDISESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKL
hide sequence
Ensembl Acc Id:
ENSMUSP00000115518 ⟸ ENSMUST00000145013
Ensembl Acc Id:
ENSMUSP00000020513 ⟸ ENSMUST00000020513
Ensembl Acc Id:
ENSMUSP00000099927 ⟸ ENSMUST00000102863
RGD ID: 6821499 Promoter ID: MM_KWN:6699 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000011791, UC007IFR.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 23,794,954 - 23,795,454 (-) MPROMDB
RGD ID: 8674132 Promoter ID: EPDNEW_M15097 Type: initiation region Name: Papolg_1 Description: Mus musculus poly polymerase gamma , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 23,895,239 - 23,895,299 EPDNEW
