Symbol:
Hacl1
Name:
2-hydroxyacyl-CoA lyase 1
RGD ID:
1553280
MGI Page
MGI
Description:
Enables carbon-carbon lyase activity. Involved in fatty acid alpha-oxidation. Acts upstream of or within lipid metabolic process. Predicted to be located in nucleoplasm. Predicted to be active in peroxisome. Is expressed in several structures, including adipose tissue; alimentary system; eye; genitourinary system; and nervous system. Orthologous to human HACL1 (2-hydroxyacyl-CoA lyase 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1600020H07Rik; 2-HPCL; 2-hydroxyphytanoyl-CoA lyase; Hp; Hpcl; Phyh; Phyh2; phytanoyl-CoA 2-hydroxylase 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HACL1 (2-hydroxyacyl-CoA lyase 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Hacl1 (2-hydroxyacyl-CoA lyase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hacl1 (2-hydroxyacyl-CoA lyase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HACL1 (2-hydroxyacyl-CoA lyase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LOC608697 (2-hydroxyacyl-CoA lyase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hacl1 (2-hydroxyacyl-CoA lyase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HACL1 (2-hydroxyacyl-CoA lyase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HACL1 (2-hydroxyacyl-CoA lyase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hacl1 (2-hydroxyacyl-CoA lyase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Hacl1 (2-hydroxyacyl-CoA lyase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HACL1 (2-hydroxyacyl-CoA lyase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hacl1 (2-hydroxyacyl-CoA lyase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG11208
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
B0334.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PXP1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
hacl1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 31,329,183 - 31,364,201 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 31,320,687 - 31,363,243 (-) Ensembl GRCm39 Ensembl GRCm38 14 31,607,226 - 31,640,965 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 31,598,730 - 31,641,286 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 32,420,412 - 32,454,151 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 30,436,235 - 30,469,970 (-) NCBI MGSCv36 mm8 Celera 14 27,864,878 - 27,898,614 (-) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 19.23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hacl1 Mouse 1-naphthyl isothiocyanate decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in decreased expression of HACL1 mRNA CTD PMID:30723492 Hacl1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HACL1 mRNA CTD PMID:19484750 and PMID:39298647 Hacl1 Mouse 17beta-estradiol affects expression ISO Hacl1 (Rattus norvegicus) 6480464 Estradiol affects the expression of HACL1 mRNA CTD PMID:32145629 Hacl1 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Hacl1 (Rattus norvegicus) 6480464 [3 more ... CTD PMID:16984957 Hacl1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:30294300 Hacl1 Mouse 2,3,7,8-tetrabromodibenzodioxine increases expression EXP 6480464 2 more ... CTD PMID:27604104 Hacl1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of HACL1 mRNA and AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of HACL1 mRNA] CTD PMID:19759094 and PMID:25975270 Hacl1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HACL1 mRNA CTD PMID:20959002 more ... Hacl1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hacl1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of HACL1 mRNA CTD PMID:22298810 Hacl1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HACL1 mRNA CTD PMID:18796159 more ... Hacl1 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Hacl1 Mouse 2,4-dinitrotoluene affects expression ISO Hacl1 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of HACL1 mRNA CTD PMID:21346803 Hacl1 Mouse 2,6-dinitrotoluene affects expression ISO Hacl1 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of HACL1 mRNA CTD PMID:21346803 Hacl1 Mouse 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Hacl1 (Rattus norvegicus) 6480464 [3 more ... CTD PMID:16984957 Hacl1 Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 3 more ... CTD PMID:20959002 Hacl1 Mouse 3H-1,2-dithiole-3-thione decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 1 and 2-dithiol-3-thione results in decreased expression of HACL1 mRNA CTD PMID:19162173 Hacl1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of HACL1 mRNA CTD PMID:33297965 and PMID:39298647 Hacl1 Mouse 4,4'-sulfonyldiphenol increases expression ISO HACL1 (Homo sapiens) 6480464 bisphenol S results in increased expression of HACL1 protein CTD PMID:34186270 Hacl1 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of HACL1 mRNA CTD PMID:28973697 Hacl1 Mouse acetamide decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 acetamide results in decreased expression of HACL1 mRNA CTD PMID:31881176 Hacl1 Mouse aconitine increases expression ISO Hacl1 (Rattus norvegicus) 6480464 Aconitine results in increased expression of HACL1 protein CTD PMID:33236894 Hacl1 Mouse aflatoxin B1 affects expression ISO HACL1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of HACL1 protein CTD PMID:20106945 Hacl1 Mouse aflatoxin B1 increases methylation ISO HACL1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of HACL1 gene CTD PMID:27153756 Hacl1 Mouse aflatoxin B1 decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Aflatoxin B1 results in decreased expression of HACL1 mRNA CTD PMID:23630614 and PMID:33354967 Hacl1 Mouse aflatoxin B1 decreases expression ISO HACL1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of HACL1 mRNA CTD PMID:22100608 Hacl1 Mouse all-trans-retinoic acid decreases expression ISO HACL1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of HACL1 mRNA CTD PMID:33167477 Hacl1 Mouse ammonium chloride affects expression ISO Hacl1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of HACL1 mRNA CTD PMID:16483693 Hacl1 Mouse Aroclor 1254 decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of HACL1 mRNA CTD PMID:18178546 Hacl1 Mouse arsenous acid multiple interactions ISO HACL1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to HACL1 protein] CTD PMID:26598702 Hacl1 Mouse atazanavir sulfate multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of HACL1 mRNA CTD PMID:33819548 Hacl1 Mouse benzene affects expression ISO Hacl1 (Rattus norvegicus) 6480464 Benzene affects the expression of HACL1 mRNA CTD PMID:15878777 Hacl1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of HACL1 mRNA CTD PMID:19770486 Hacl1 Mouse benzo[a]pyrene decreases expression ISO HACL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HACL1 mRNA CTD PMID:32234424 Hacl1 Mouse bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of HACL1 mRNA CTD PMID:15674844 Hacl1 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of HACL1 mRNA] CTD PMID:19850644 Hacl1 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of HACL1 mRNA CTD PMID:19245819 and PMID:19850644 Hacl1 Mouse bisphenol A increases expression ISO Hacl1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of HACL1 mRNA CTD PMID:25181051 Hacl1 Mouse bisphenol A decreases expression ISO HACL1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HACL1 protein CTD PMID:34186270 Hacl1 Mouse bisphenol A decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of HACL1 mRNA CTD PMID:30816183 more ... Hacl1 Mouse bisphenol A affects expression ISO Hacl1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of HACL1 mRNA CTD PMID:30903817 and PMID:32145629 Hacl1 Mouse bisphenol AF increases expression ISO HACL1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of HACL1 protein CTD PMID:34186270 Hacl1 Mouse Bisphenol B increases expression ISO HACL1 (Homo sapiens) 6480464 bisphenol B results in increased expression of HACL1 protein CTD PMID:34186270 Hacl1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of HACL1 mRNA CTD PMID:38685157 Hacl1 Mouse bisphenol F increases expression ISO HACL1 (Homo sapiens) 6480464 bisphenol F results in increased expression of HACL1 protein CTD PMID:34186270 Hacl1 Mouse bromuconazole increases expression ISO Hacl1 (Rattus norvegicus) 6480464 bromuconazole results in increased expression of HACL1 mRNA CTD PMID:33789219 Hacl1 Mouse buspirone increases expression ISO Hacl1 (Rattus norvegicus) 6480464 Buspirone results in increased expression of HACL1 mRNA CTD PMID:24136188 Hacl1 Mouse C60 fullerene increases expression ISO Hacl1 (Rattus norvegicus) 6480464 fullerene C60 results in increased expression of HACL1 mRNA CTD PMID:19167457 Hacl1 Mouse carbamazepine affects expression ISO HACL1 (Homo sapiens) 6480464 Carbamazepine affects the expression of HACL1 mRNA CTD PMID:25979313 Hacl1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Hacl1 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25620056 Hacl1 Mouse carmustine decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Carmustine results in decreased expression of HACL1 mRNA CTD PMID:16005536 Hacl1 Mouse chenodeoxycholic acid multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of HACL1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of HACL1 mRNA CTD PMID:33819548 Hacl1 Mouse cholesterol multiple interactions EXP 6480464 [Cholesterol co-treated with 1 and 2-dioleoyloxy-3-(trimethylammonium)propane] results in increased expression of HACL1 mRNA CTD PMID:22129739 Hacl1 Mouse chromium trinitrate increases expression EXP 6480464 chromium nitrate results in increased expression of HACL1 protein CTD PMID:22144121 Hacl1 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of HACL1 mRNA CTD PMID:28472532 Hacl1 Mouse cisplatin increases expression ISO HACL1 (Homo sapiens) 6480464 Cisplatin results in increased expression of HACL1 mRNA CTD PMID:27392435 Hacl1 Mouse cisplatin multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of HACL1 mRNA CTD PMID:27392435 Hacl1 Mouse clofibrate increases expression ISO Hacl1 (Rattus norvegicus) 6480464 Clofibrate results in increased expression of HACL1 mRNA CTD PMID:12851107 Hacl1 Mouse clofibric acid affects expression ISO Hacl1 (Rattus norvegicus) 6480464 Clofibric Acid affects the expression of HACL1 mRNA CTD PMID:17602206 Hacl1 Mouse cobalt dichloride decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of HACL1 mRNA CTD PMID:24386269 Hacl1 Mouse cyclosporin A decreases expression ISO HACL1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HACL1 mRNA CTD PMID:20106945 Hacl1 Mouse cyclosporin A decreases methylation ISO HACL1 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of HACL1 promoter CTD PMID:27989131 Hacl1 Mouse cyclosporin A increases expression ISO HACL1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HACL1 mRNA CTD PMID:25562108 Hacl1 Mouse decabromodiphenyl ether increases expression ISO Hacl1 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of HACL1 mRNA CTD PMID:23640034 Hacl1 Mouse deoxycholic acid multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of HACL1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of HACL1 mRNA CTD PMID:33819548 Hacl1 Mouse diarsenic trioxide multiple interactions ISO HACL1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to HACL1 protein] CTD PMID:26598702 Hacl1 Mouse dibenzofurans increases expression EXP 6480464 Dibenzofurans results in increased expression of HACL1 mRNA CTD PMID:34254344 Hacl1 Mouse dicrotophos decreases expression ISO HACL1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of HACL1 mRNA CTD PMID:28302478 Hacl1 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of HACL1 mRNA CTD PMID:30529165 Hacl1 Mouse diquat increases expression EXP 6480464 Diquat results in increased expression of HACL1 mRNA CTD PMID:36851058 Hacl1 Mouse doxorubicin increases expression ISO HACL1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of HACL1 mRNA CTD PMID:29803840 Hacl1 Mouse epoxiconazole affects expression EXP 6480464 epoxiconazole affects the expression of HACL1 mRNA CTD PMID:35436446 Hacl1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of HACL1 mRNA CTD PMID:30319688 Hacl1 Mouse flutamide decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of HACL1 mRNA CTD PMID:24136188 Hacl1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of HACL1 mRNA CTD PMID:25629700 Hacl1 Mouse furan increases methylation ISO Hacl1 (Rattus norvegicus) 6480464 furan results in increased methylation of HACL1 gene CTD PMID:22079235 Hacl1 Mouse glafenine decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Glafenine results in decreased expression of HACL1 mRNA CTD PMID:24136188 Hacl1 Mouse glycochenodeoxycholic acid multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of HACL1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of HACL1 mRNA CTD PMID:33819548 Hacl1 Mouse glycocholic acid multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of HACL1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of HACL1 mRNA CTD PMID:33819548 Hacl1 Mouse glycodeoxycholic acid multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of HACL1 mRNA and [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Atazanavir Sulfate] results in decreased expression of HACL1 mRNA CTD PMID:33819548 Hacl1 Mouse ivermectin decreases expression ISO HACL1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HACL1 protein CTD PMID:32959892 Hacl1 Mouse methapyrilene decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Methapyrilene results in decreased expression of HACL1 mRNA CTD PMID:30467583 Hacl1 Mouse methotrexate decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Methotrexate results in decreased expression of HACL1 mRNA CTD PMID:16005536 Hacl1 Mouse Muraglitazar increases expression ISO Hacl1 (Rattus norvegicus) 6480464 muraglitazar results in increased expression of HACL1 mRNA CTD PMID:21515302 Hacl1 Mouse N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of HACL1 mRNA CTD PMID:24535843 Hacl1 Mouse N-nitrosodiethylamine multiple interactions ISO Hacl1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of HACL1 mRNA CTD PMID:28943392 Hacl1 Mouse nickel atom decreases expression ISO HACL1 (Homo sapiens) 6480464 Nickel results in decreased expression of HACL1 mRNA CTD PMID:25583101 Hacl1 Mouse nimesulide increases expression ISO Hacl1 (Rattus norvegicus) 6480464 nimesulide results in increased expression of HACL1 mRNA CTD PMID:24136188 Hacl1 Mouse okadaic acid increases expression ISO HACL1 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of HACL1 protein CTD PMID:38832940 Hacl1 Mouse oxycodone increases expression ISO Hacl1 (Rattus norvegicus) 6480464 Oxycodone results in increased expression of HACL1 mRNA CTD PMID:23439660 Hacl1 Mouse paclitaxel increases expression ISO Hacl1 (Rattus norvegicus) 6480464 Paclitaxel results in increased expression of HACL1 mRNA CTD PMID:15585946 Hacl1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of HACL1 mRNA CTD PMID:17562736 Hacl1 Mouse paracetamol multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of HACL1 mRNA CTD PMID:33819548 Hacl1 Mouse paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of HACL1 mRNA CTD PMID:29246445 Hacl1 Mouse paracetamol multiple interactions EXP 6480464 PANX1 gene mutant form promotes the reaction [Acetaminophen results in decreased expression of HACL1 mRNA] CTD PMID:29246445 Hacl1 Mouse perfluorooctanoic acid increases expression ISO Hacl1 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in increased expression of HACL1 mRNA and perfluorooctanoic acid results in increased expression of HACL1 protein CTD PMID:16221955 more ... Hacl1 Mouse pirinixic acid multiple interactions ISO HACL1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of HACL1 mRNA CTD PMID:19710929 Hacl1 Mouse pirinixic acid increases expression ISO Hacl1 (Rattus norvegicus) 6480464 pirinixic acid results in increased expression of HACL1 mRNA CTD PMID:19162173 and PMID:22484513 Hacl1 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of HACL1 mRNA and pirinixic acid results in increased expression of HACL1 protein CTD PMID:15226431 more ... Hacl1 Mouse potassium chromate increases expression EXP 6480464 potassium chromate(VI) results in increased expression of HACL1 protein CTD PMID:22144121 Hacl1 Mouse quercetin decreases expression ISO HACL1 (Homo sapiens) 6480464 Quercetin results in decreased expression of HACL1 mRNA CTD PMID:21632981 Hacl1 Mouse resveratrol multiple interactions ISO HACL1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of HACL1 mRNA CTD PMID:23557933 Hacl1 Mouse sodium arsenite decreases expression ISO HACL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HACL1 mRNA CTD PMID:22714537 and PMID:25879800 Hacl1 Mouse sunitinib decreases expression ISO HACL1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of HACL1 mRNA CTD PMID:31533062 Hacl1 Mouse Tesaglitazar increases expression ISO Hacl1 (Rattus norvegicus) 6480464 tesaglitazar results in increased expression of HACL1 mRNA CTD PMID:21515302 Hacl1 Mouse tetrachloroethene increases expression EXP 6480464 Tetrachloroethylene results in increased expression of HACL1 mRNA CTD PMID:28973375 Hacl1 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of HACL1 mRNA CTD PMID:27339419 and PMID:31919559 Hacl1 Mouse tetrachloromethane decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of HACL1 mRNA CTD PMID:31150632 Hacl1 Mouse thapsigargin increases expression ISO Hacl1 (Rattus norvegicus) 6480464 Thapsigargin results in increased expression of HACL1 protein CTD PMID:35544339 Hacl1 Mouse thioacetamide decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of HACL1 mRNA CTD PMID:23411599 and PMID:34492290 Hacl1 Mouse thioacetamide multiple interactions ISO Hacl1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of HACL1 mRNA CTD PMID:28943392 Hacl1 Mouse tioguanine decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Thioguanine results in decreased expression of HACL1 mRNA CTD PMID:16005536 Hacl1 Mouse triphenyl phosphate decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 triphenyl phosphate results in decreased expression of HACL1 mRNA CTD PMID:30589522 Hacl1 Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of HACL1 protein CTD PMID:18495193 Hacl1 Mouse troglitazone increases expression EXP 6480464 troglitazone results in increased expression of HACL1 protein CTD PMID:18495193 Hacl1 Mouse troglitazone increases expression ISO Hacl1 (Rattus norvegicus) 6480464 troglitazone results in increased expression of HACL1 mRNA CTD PMID:21515302 Hacl1 Mouse trovafloxacin increases expression ISO Hacl1 (Rattus norvegicus) 6480464 trovafloxacin results in increased expression of HACL1 mRNA CTD PMID:24136188 Hacl1 Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of HACL1 mRNA CTD PMID:35537566 Hacl1 Mouse tungsten increases expression EXP 6480464 Tungsten results in increased expression of HACL1 mRNA CTD PMID:30912803 Hacl1 Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of HACL1 mRNA CTD PMID:21427059 and PMID:24489787 Hacl1 Mouse valproic acid decreases expression ISO HACL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HACL1 mRNA CTD PMID:23179753 and PMID:27188386 Hacl1 Mouse valproic acid affects expression ISO HACL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of HACL1 mRNA CTD PMID:25979313 Hacl1 Mouse zinc atom decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Zinc deficiency results in decreased expression of HACL1 mRNA CTD PMID:15671213 Hacl1 Mouse zinc(0) decreases expression ISO Hacl1 (Rattus norvegicus) 6480464 Zinc deficiency results in decreased expression of HACL1 mRNA CTD PMID:15671213
Imported Annotations - SMPDB
1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrabromodibenzodioxine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (EXP) acetamide (ISO) aconitine (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (ISO) Aroclor 1254 (ISO) arsenous acid (ISO) atazanavir sulfate (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) bromuconazole (ISO) buspirone (ISO) C60 fullerene (ISO) carbamazepine (ISO) carbon nanotube (EXP) carmustine (ISO) chenodeoxycholic acid (ISO) cholesterol (EXP) chromium trinitrate (EXP) chromium(6+) (EXP) cisplatin (ISO) clofibrate (ISO) clofibric acid (ISO) cobalt dichloride (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) deoxycholic acid (ISO) diarsenic trioxide (ISO) dibenzofurans (EXP) dicrotophos (ISO) dioxygen (EXP) diquat (EXP) doxorubicin (ISO) epoxiconazole (EXP) ethanol (EXP) flutamide (ISO) folic acid (EXP) furan (ISO) glafenine (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) ivermectin (ISO) methapyrilene (ISO) methotrexate (ISO) Muraglitazar (ISO) N-nitrosodiethylamine (EXP,ISO) nickel atom (ISO) nimesulide (ISO) okadaic acid (ISO) oxycodone (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) pirinixic acid (EXP,ISO) potassium chromate (EXP) quercetin (ISO) resveratrol (ISO) sodium arsenite (ISO) sunitinib (ISO) Tesaglitazar (ISO) tetrachloroethene (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (ISO) tioguanine (ISO) triphenyl phosphate (ISO) troglitazone (EXP,ISO) trovafloxacin (EXP,ISO) tungsten (EXP) valproic acid (EXP,ISO) zinc atom (ISO) zinc(0) (ISO)
Hacl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 31,329,183 - 31,364,201 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 31,320,687 - 31,363,243 (-) Ensembl GRCm39 Ensembl GRCm38 14 31,607,226 - 31,640,965 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 31,598,730 - 31,641,286 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 32,420,412 - 32,454,151 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 30,436,235 - 30,469,970 (-) NCBI MGSCv36 mm8 Celera 14 27,864,878 - 27,898,614 (-) NCBI Celera Cytogenetic Map 14 B NCBI cM Map 14 19.23 NCBI
HACL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 15,560,699 - 15,601,569 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 15,560,699 - 15,601,852 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 15,602,206 - 15,643,076 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 15,577,243 - 15,618,134 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 15,540,467 - 15,581,279 (-) NCBI Celera Cytogenetic Map 3 p25.1 NCBI HuRef 3 15,537,616 - 15,578,260 (-) NCBI HuRef CHM1_1 3 15,553,051 - 15,593,804 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 15,563,097 - 15,603,888 (-) NCBI T2T-CHM13v2.0
Hacl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 6,831,293 - 6,869,410 (-) NCBI GRCr8 mRatBN7.2 16 6,826,881 - 6,863,027 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 6,824,906 - 6,863,027 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 6,830,764 - 6,867,047 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 7,975,662 - 8,011,946 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 6,838,214 - 6,874,501 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 7,720,047 - 7,758,119 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 7,714,465 - 7,758,189 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 7,646,580 - 7,682,704 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 7,073,038 - 7,108,830 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 7,073,036 - 7,108,828 (-) NCBI Celera 16 8,335,334 - 8,371,457 (+) NCBI Celera Cytogenetic Map 16 p16 NCBI
Hacl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955430 2,053,640 - 2,096,432 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955430 2,055,774 - 2,096,260 (-) NCBI ChiLan1.0 ChiLan1.0
HACL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 15,546,138 - 15,586,459 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 15,550,904 - 15,591,223 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 15,486,897 - 15,526,552 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 15,823,979 - 15,863,982 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 15,823,979 - 15,863,982 (-) Ensembl panpan1.1 panPan2
LOC608697 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 27,069,676 - 27,188,247 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 27,043,917 - 27,162,593 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 27,572,135 - 27,700,471 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 23 27,271,635 - 27,389,865 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 27,333,444 - 27,451,635 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 27,581,893 - 27,700,406 (+) NCBI UU_Cfam_GSD_1.0
Hacl1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 169,684,583 - 169,717,508 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936473 2,823,123 - 2,856,077 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936473 2,823,183 - 2,856,077 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HACL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 2,766,514 - 2,840,902 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 2,786,007 - 2,840,882 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 2,714,442 - 2,737,983 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HACL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 60,360,380 - 60,433,528 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 60,322,722 - 60,433,647 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 33,390,238 - 33,465,437 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hacl1
.
Predicted Target Of
Count of predictions: 2507 Count of miRNA genes: 760 Interacting mature miRNAs: 957 Transcripts: ENSMUST00000022437, ENSMUST00000127204, ENSMUST00000128629, ENSMUST00000134626, ENSMUST00000135751, ENSMUST00000139501, ENSMUST00000140078, ENSMUST00000155210, ENSMUST00000156189, ENSMUST00000156431, ENSMUST00000165955, ENSMUST00000167066, ENSMUST00000167175, ENSMUST00000171414 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357589 Kdnw2_m kidney weight 2 (mouse) Not determined 14 20887473 121269804 Mouse 27226748 Femd8_m femur midshaft diameter 8, 10 week (mouse) 14 13769273 46737457 Mouse 1357527 Epfpq1_m epididymal fat percentage QTL 1 (mouse) Not determined 14 21062450 71885801 Mouse 27226744 Metcl6_m metatarsal-calcaneal length 6, 5 week (mouse) 14 30321957 52937457 Mouse 27226775 Tibl7_m tibia length 7, 5 week (mouse) 14 30321957 48837457 Mouse 27226774 Tibl15_m tibia length 15, 10 week (mouse) 14 30321957 87937436 Mouse 4142485 Modor2_m modifier of ocular retardation 2 (mouse) Not determined 14 24926248 58179769 Mouse 1301372 Sluc13_m susceptibility to lung cancer 13 (mouse) Not determined 14 18827604 52827726 Mouse 4141550 Dbm3_m diabetes modifier 3 (mouse) Not determined 5143473 39143596 Mouse 1300544 Hypn_m hyperinsulinemia (mouse) Not determined 14 15160616 49160765 Mouse 1301991 Wta3_m weight adult 3 (mouse) Not determined 14 3887473 37887650 Mouse 1300998 Cia17_m collagen induced arthritis 17 (mouse) Not determined 14 30335250 64335381 Mouse 4141864 Mrdq4_m modifier of retinal degeneration QTL 4 (mouse) Not determined 9923245 48765082 Mouse 10043886 Cia49_m collagen induced arthritis QTL 49 (mouse) Not determined 14 29996994 63997133 Mouse 1300779 Dyscalc4_m dystrophic cardiac calcinosis 4 (mouse) Not determined 14 12212871 46213007 Mouse 14746973 Manh76_m mandible shape 76 (mouse) 14 22287217 56287217 Mouse 1300909 Ath13_m atherosclerosis 13 (mouse) Not determined 14 30335250 64335381 Mouse 27226752 Femd4_m femur midshaft diameter 4, 5 week (mouse) 14 13769273 47237457 Mouse 13506929 Recrq10_m recombination rate in male meiosis QTL 10 (mouse) 14 27921957 61137449 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000022437 ⟹ ENSMUSP00000022437
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,329,156 - 31,362,921 (-) Ensembl GRCm38.p6 Ensembl 14 31,607,199 - 31,640,964 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000127204 ⟹ ENSMUSP00000120452
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,329,968 - 31,362,869 (-) Ensembl GRCm38.p6 Ensembl 14 31,608,011 - 31,640,912 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000128629
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,351,724 - 31,363,214 (-) Ensembl GRCm38.p6 Ensembl 14 31,629,767 - 31,641,257 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000134626 ⟹ ENSMUSP00000114879
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,348,383 - 31,363,129 (-) Ensembl GRCm38.p6 Ensembl 14 31,626,426 - 31,641,172 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000135751
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,357,605 - 31,363,243 (-) Ensembl GRCm38.p6 Ensembl 14 31,635,648 - 31,641,286 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000139501
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,329,926 - 31,332,291 (-) Ensembl GRCm38.p6 Ensembl 14 31,607,969 - 31,610,334 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000140078 ⟹ ENSMUSP00000154592
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,329,622 - 31,336,268 (-) Ensembl GRCm38.p6 Ensembl 14 31,607,665 - 31,614,311 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000155210
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,352,536 - 31,362,903 (-) Ensembl GRCm38.p6 Ensembl 14 31,630,579 - 31,640,946 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000156189
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,357,466 - 31,362,868 (-) Ensembl GRCm38.p6 Ensembl 14 31,635,509 - 31,640,911 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000156431 ⟹ ENSMUSP00000114922
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,320,687 - 31,362,901 (-) Ensembl GRCm38.p6 Ensembl 14 31,598,730 - 31,640,944 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000165955 ⟹ ENSMUSP00000129090
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,329,968 - 31,362,835 (-) Ensembl GRCm38.p6 Ensembl 14 31,608,011 - 31,640,878 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000167066 ⟹ ENSMUSP00000132913
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,329,968 - 31,362,835 (-) Ensembl GRCm38.p6 Ensembl 14 31,608,011 - 31,640,878 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000171414 ⟹ ENSMUSP00000130268
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 14 31,329,968 - 31,362,835 (-) Ensembl GRCm38.p6 Ensembl 14 31,608,011 - 31,640,878 (-) Ensembl
RefSeq Acc Id:
NM_019975 ⟹ NP_064359
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 31,329,183 - 31,362,922 (-) NCBI GRCm38 14 31,607,226 - 31,640,965 (-) NCBI MGSCv37 14 32,420,412 - 32,454,151 (-) RGD Celera 14 27,864,878 - 27,898,614 (-) RGD cM Map 14 ENTREZGENE
Sequence:
TGTCAGAAGCGGGTGTCACCAACAACAACTCTTAGGCTAGTGAAGCTGTGAGCTGCGAGAGTGCCTTGAAGTAACTTTAGGTGGAAGATGCCAGAAAGTAACTCCGCAGAGGGTAGCGACAGAAGCGA
hide sequence
RefSeq Acc Id:
XM_036158767 ⟹ XP_036014660
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 14 31,329,822 - 31,364,201 (-) NCBI
Sequence:
GTGAGCCACCACATCTGGCGCTACGATGCCAAATCTCACCAAAATAACAAATAACATTTTAAGC
hide sequence
RefSeq Acc Id:
NP_064359 ⟸ NM_019975
- UniProtKB:
Q543K1 (UniProtKB/Swiss-Prot), Q9DAV1 (UniProtKB/Swiss-Prot), Q9QXE0 (UniProtKB/Swiss-Prot), D3YZ54 (UniProtKB/TrEMBL)
- Sequence:
MPESNSAEGSDRSEEQVSGAKVIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGMRNEQAACYAASAVGYLTGRPGVCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEF
hide sequence
Ensembl Acc Id:
ENSMUSP00000120452 ⟸ ENSMUST00000127204
Ensembl Acc Id:
ENSMUSP00000130268 ⟸ ENSMUST00000171414
Ensembl Acc Id:
ENSMUSP00000129090 ⟸ ENSMUST00000165955
Ensembl Acc Id:
ENSMUSP00000022437 ⟸ ENSMUST00000022437
Ensembl Acc Id:
ENSMUSP00000154592 ⟸ ENSMUST00000140078
Ensembl Acc Id:
ENSMUSP00000114879 ⟸ ENSMUST00000134626
Ensembl Acc Id:
ENSMUSP00000132913 ⟸ ENSMUST00000167066
Ensembl Acc Id:
ENSMUSP00000114922 ⟸ ENSMUST00000156431
RefSeq Acc Id:
XP_036014660 ⟸ XM_036158767
- Peptide Label:
isoform X1
- UniProtKB:
D3YZ54 (UniProtKB/TrEMBL)
RGD ID: 8681840 Promoter ID: EPDNEW_M18951 Type: multiple initiation site Name: Hacl1_1 Description: Mus musculus 2-hydroxyacyl-CoA lyase 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 14 31,640,961 - 31,641,021 EPDNEW
RGD ID: 6825054 Promoter ID: MM_KWN:16116 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Liver Transcripts: OTTMUST00000060715 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 32,423,466 - 32,424,217 (-) MPROMDB
RGD ID: 6825053 Promoter ID: MM_KWN:16117 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Liver Transcripts: OTTMUST00000060361 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 32,427,616 - 32,428,367 (-) MPROMDB
RGD ID: 6825055 Promoter ID: MM_KWN:16118 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_2Hour, BoneMarrow_4Hour, Liver, MEF_B6, Spleen Transcripts: NM_019975, OTTMUST00000060362, OTTMUST00000060363, OTTMUST00000060374, OTTMUST00000060375, OTTMUST00000060376, OTTMUST00000060377, UC007SXW.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 14 32,454,071 - 32,455,417 (-) MPROMDB
