No known orthologs.
Symbol:
Or4f53
Name:
olfactory receptor family 4 subfamily F member 53
RGD ID:
1552914
MGI Page
MGI
Description:
Predicted to enable olfactory receptor activity. Predicted to act upstream of or within G protein-coupled receptor signaling pathway and sensory perception of smell. Predicted to be located in membrane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
GA_x6K02T2Q125-72308574-72309512; MOR245-; MOR245-10; olfactory receptor 1276; olfactory receptor MOR245-10; Olfr1276
RGD Orthologs
Alliance Orthologs
More Info
homologs ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 111,087,462 - 111,088,400 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 111,084,861 - 111,092,371 (+) Ensembl GRCm39 Ensembl GRCm38 2 111,257,117 - 111,258,055 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 111,254,516 - 111,262,026 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 111,097,274 - 111,098,212 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 111,057,956 - 111,058,894 (+) NCBI MGSCv36 mm8 Celera 2 112,413,280 - 112,414,218 (+) NCBI Celera Cytogenetic Map 2 E3 NCBI cM Map 2 56.75 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
.
Predicted Target Of
Count of predictions: 60 Count of miRNA genes: 59 Interacting mature miRNAs: 60 Transcripts: ENSMUST00000073322 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
13824983 Vclq1_m curvilinear velocity QTL 1 (mouse) 2 61830344 136841920 Mouse 1301909 Smdq2_m segregation of mitochondrial DNA QTL 2 (mouse) Not determined 2 92778465 126778607 Mouse 1302174 Dssc2_m dextran sodium sulfate induced colitis QTL2 (mouse) Not determined 2 24224632 148700377 Mouse 1558915 W3q1_m weight 3 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 11532731 Sluc31a_m susceptibility to lung cancer 31a (mouse) 2 88015003 122015170 Mouse 27226761 Feml18_m femur length 18, 16 week (mouse) 2 94230345 154241920 Mouse 1357454 Kidq1_m kidney weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357577 Trmq3_m T cell ratio modifier QTL 3 (mouse) Not determined 2 60520612 119355518 Mouse 1558966 W10q9_m weight 10 weeks QTL 9 (mouse) Not determined 2 20897778 118894840 Mouse 4141854 T2dm2sa_m type 2 diabetes mellitus 2 in SMXA RI mice (mouse) Not determined 2 29307947 148374934 Mouse 12904935 Edlmmq2_m extensor digitorum longus muscle mass QTL 2 (mouse) 2 97210364 131210364 Mouse 1302071 Fembrs1_m femur breaking strength 1 (mouse) Not determined 2 100942930 134943090 Mouse 10045885 Cplaq15_m circadian period of locomotor activity 15 (mouse) Not determined 2 110916118 154354667 Mouse 1302203 Gvhd3_m graft-versus host disease 3 (mouse) Not determined 2 100942930 134943090 Mouse 10412082 Hylaq1_m Hyperlocomotor activity related QTL 1 (mouse) Not determined 2 84013198 148667470 Mouse 1357881 Estoq1_m embryo survival total QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 5491197 Mobq5_m multigenic obesity QTL 5 (mouse) Not determined 2 65269746 162518926 Mouse 5491196 Mobq6_m multigenic obesity QTL 6 (mouse) Not determined 2 85724269 180896594 Mouse 15092054 Egrme5_m early growth rate, maternal effect 5 (mouse) 2 82190187 118004745 Mouse 4142223 Femwf4_m femur work to failure 4 (mouse) Not determined 88143423 122143570 Mouse 4142088 Parms1_m patched associated RMS 1 (mouse) Not determined 74524117 114123532 Mouse 4141448 Mpaps1_m microphthalmia anophthalmia susceptibility 1 (mouse) Not determined 97028557 112115196 Mouse 27226788 Feml13_m femur length 13, 10 week (mouse) 2 102630345 159941920 Mouse 12904954 Gmmq2_m gastrocnemius muscle mass QTL 2 (mouse) 2 97210364 131210364 Mouse 11038697 Ltpr2d_m Leishmania tropica response 2d (mouse) 2 86095716 120095823 Mouse 1301330 Tbbmd2_m total body bone mineral density 2 (mouse) Not determined 2 100942930 134943090 Mouse 11038698 Ltpr2c_m Leishmania tropica response 2c (mouse) 2 86095716 120095823 Mouse 39128209 Lwq14_m liver weight QTL 14 (mouse) 2 20897778 118894840 Mouse 1558738 W6q1_m weight 6 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 11038702 Ltpr2_m Leishmania tropica response 2 (mouse) 2 103095716 167212356 Mouse 11049568 Lmr28c_m leishmaniasis resistance 28c (mouse) 2 97123370 131123532 Mouse 11049569 Lmr28d_m leishmaniasis resistance 28d (mouse) 2 97123370 131123532 Mouse 11528549 Sluc31_m susceptibility to lung cancer 31 (mouse) 2 74524117 129213005 Mouse 1301087 Bbaa15_m B.burgdorferi-associated arthritis 15 (mouse) Not determined 2 110489658 144489807 Mouse 1301825 Pbrgcsf1_m peripheral blood stem cell response to granulocyte colony stimulating factor 1 (mouse) Not determined 2 106233580 140233729 Mouse 4141802 Ignpq1_m IgA nephropathy QTL 1 (mouse) Not determined 2 100824060 134824269 Mouse 1301834 Bits1_m bitterness sensitivity 1 (mouse) Not determined 2 87440643 121440778 Mouse 11041906 Lmr28a_m leishmaniasis resistance 28a (mouse) 2 103095716 129213005 Mouse 4141155 Plast2b_m plasma plant sterol 2b (mouse) Not determined 2 84013198 148522175 Mouse 1558901 Skmw8_m skeletal muscle weight 8 (mouse) Not determined 2 84008488 118008593 Mouse 1558899 Egq1_m early growth QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357681 Hrtq1_m heart weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1301109 Dntcs2_m dental caries susceptibility 2 (mouse) Not determined 2 40885493 114910165 Mouse 1300852 Lmr14_m leishmaniasis resistance 14 (mouse) Not determined 2 86095716 120095823 Mouse 1357436 Splq1_m spleen weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 10043894 Bw22_m body weight QTL 22 (mouse) Not determined 2 80895334 114895334 Mouse 1301344 Lith1_m lithogenic gene 1 (mouse) Not determined 2 45347635 145312647 Mouse 11049565 Lmr28g_m leishmaniasis resistance 28g (mouse) 2 86095716 120095823 Mouse 1301098 Cd8mts3_m CD8 memory T cell subset 3 (mouse) Not determined 2 91089974 125090104 Mouse 10043875 Bw25_m body weight QTL 25 (mouse) Not determined 2 107255676 141255676 Mouse
UniSTS:485086
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 111,257,117 - 111,258,055 UniSTS GRCm38 MGSCv37 2 111,097,274 - 111,098,212 UniSTS GRCm37 Celera 2 112,413,280 - 112,414,218 UniSTS Cytogenetic Map 2 E3 UniSTS
UniSTS:495594
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 111,257,038 - 111,258,086 UniSTS GRCm38 MGSCv37 2 111,097,195 - 111,098,243 UniSTS GRCm37 Celera 2 112,413,201 - 112,414,249 UniSTS Cytogenetic Map 2 E3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000073322 ⟹ ENSMUSP00000073046
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 111,087,462 - 111,088,400 (+) Ensembl GRCm38.p6 Ensembl 2 111,257,117 - 111,258,055 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000213658
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 111,084,861 - 111,092,371 (+) Ensembl GRCm38.p6 Ensembl 2 111,254,516 - 111,262,026 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000218065 ⟹ ENSMUSP00000151987
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 111,084,861 - 111,092,371 (+) Ensembl GRCm38.p6 Ensembl 2 111,254,516 - 111,262,026 (+) Ensembl
RefSeq Acc Id:
NM_146395 ⟹ NP_666507
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 111,087,462 - 111,088,400 (+) NCBI GRCm38 2 111,257,117 - 111,258,055 (+) ENTREZGENE MGSCv37 2 111,097,274 - 111,098,212 (+) RGD Celera 2 112,413,280 - 112,414,218 (+) RGD cM Map 2 ENTREZGENE
Sequence:
ATGAATGAAATAAATTACACCGAGGTGTCTGAATTTGTGTTTCTGGGACTTTCAACATCTAAACACATACAGCATTTCTTTCTTGCCTTCTCTGTGGTATTTTATGTGACCATTGTGCTGGGCAATAC
hide sequence
RefSeq Acc Id:
NP_666507 ⟸ NM_146395
- UniProtKB:
Q8VF40 (UniProtKB/TrEMBL)
- Sequence:
MNEINYTEVSEFVFLGLSTSKHIQHFFLAFSVVFYVTIVLGNTLVVFTLAFDPHLHSPMYFLLGNLSFIDLCLSTLTVPKMISDLSSGHNTISFQGCVFQIFVLHVLGASEMVLLVAMAWDRYVAICK
hide sequence
Ensembl Acc Id:
ENSMUSP00000151987 ⟸ ENSMUST00000218065
Ensembl Acc Id:
ENSMUSP00000073046 ⟸ ENSMUST00000073322
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-05-24
Or4f53
olfactory receptor family 4 subfamily F member 53
Olfr1276
olfactory receptor 1276
Symbol and/or name change
5135510 APPROVED
