Symbol:
Zmat3
Name:
zinc finger matrin type 3
RGD ID:
1552389
MGI Page
MGI
Description:
Predicted to enable RNA binding activity and zinc ion binding activity. Predicted to be involved in positive regulation of apoptotic process. Predicted to act upstream of or within negative regulation of cell growth. Predicted to be located in nucleoplasm and plasma membrane. Is expressed in several structures, including early conceptus; genitourinary system; and heart. Orthologous to human ZMAT3 (zinc finger matrin-type 3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
p53-activated gene 608 protein; Wig; Wig1; wild-type p53-induced gene 1 protein; zinc finger matrin-type protein 3; zinc finger protein WIG-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ZMAT3 (zinc finger matrin-type 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Zmat3 (zinc finger, matrin type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Zmat3 (zinc finger matrin-type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ZMAT3 (zinc finger matrin-type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ZMAT3 (zinc finger matrin-type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Zmat3 (zinc finger matrin-type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ZMAT3 (zinc finger matrin-type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ZMAT3 (zinc finger matrin-type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Zmat3 (zinc finger matrin-type 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Zmat3 (zinc finger, matrin type 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ZMAT3 (zinc finger matrin-type 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zmat3 (zinc finger, matrin-type 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG1231
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
dbf
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
zmat3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 32,388,941 - 32,419,814 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 32,388,941 - 32,420,163 (-) Ensembl GRCm39 Ensembl GRCm38 3 32,334,792 - 32,365,665 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 32,334,792 - 32,366,014 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 32,233,714 - 32,264,587 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 32,526,345 - 32,557,169 (-) NCBI MGSCv36 mm8 Celera 3 32,246,614 - 32,279,808 (-) NCBI Celera Cytogenetic Map 3 A3 NCBI cM Map 3 15.67 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zmat3 Mouse (+)-schisandrin B multiple interactions ISO Zmat3 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ZMAT3 mRNA] CTD PMID:31150632 Zmat3 Mouse (-)-demecolcine increases expression ISO ZMAT3 (Homo sapiens) 6480464 Demecolcine results in increased expression of ZMAT3 mRNA CTD PMID:23649840 Zmat3 Mouse 1,1-dichloroethene increases expression EXP 6480464 vinylidene chloride results in increased expression of ZMAT3 mRNA CTD PMID:26682919 Zmat3 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZMAT3 mRNA CTD PMID:22206623 Zmat3 Mouse 1-nitropropane decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 1-nitropropane results in decreased expression of ZMAT3 mRNA CTD PMID:17070881 Zmat3 Mouse 17alpha-ethynylestradiol increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of ZMAT3 mRNA CTD PMID:15212814 and PMID:29097150 Zmat3 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ZMAT3 mRNA CTD PMID:21570461 Zmat3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZMAT3 mRNA CTD PMID:33387578 Zmat3 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Zmat3 Mouse 2,4-diaminotoluene increases expression ISO Zmat3 (Rattus norvegicus) 6480464 2 and 4-diaminotoluene results in increased expression of ZMAT3 mRNA CTD PMID:17070881 Zmat3 Mouse 2,4-dinitrotoluene affects expression ISO Zmat3 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of ZMAT3 mRNA CTD PMID:21346803 Zmat3 Mouse 2,6-diaminotoluene increases expression ISO Zmat3 (Rattus norvegicus) 6480464 2 and 6-diaminotoluene results in increased expression of ZMAT3 mRNA CTD PMID:17070881 Zmat3 Mouse 2-acetamidofluorene multiple interactions EXP 6480464 TRP53 protein modified form affects the reaction [2-Acetylaminofluorene affects the expression of ZMAT3 mRNA] CTD PMID:17317680 Zmat3 Mouse 2-acetamidofluorene increases expression ISO Zmat3 (Rattus norvegicus) 6480464 2-Acetylaminofluorene results in increased expression of ZMAT3 mRNA CTD PMID:17070881 more ... Zmat3 Mouse 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of ZMAT3 mRNA CTD PMID:17317680 and PMID:21607683 Zmat3 Mouse 2-nitro-p-phenylenediamine decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 2-nitro-4-phenylenediamine results in decreased expression of ZMAT3 mRNA CTD PMID:17070881 Zmat3 Mouse 2-nitrofluorene increases expression ISO Zmat3 (Rattus norvegicus) 6480464 2-nitrofluorene results in increased expression of ZMAT3 mRNA CTD PMID:14600272 and PMID:15890375 Zmat3 Mouse 2-nitropropane increases expression ISO Zmat3 (Rattus norvegicus) 6480464 2-nitropropane results in increased expression of ZMAT3 mRNA CTD PMID:17070881 Zmat3 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ZMAT3 mRNA CTD PMID:28628672 Zmat3 Mouse 3-methylcholanthrene multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to ZMAT3 promoter] CTD PMID:20348232 Zmat3 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of ZMAT3 gene CTD PMID:31683443 Zmat3 Mouse 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression ISO Zmat3 (Rattus norvegicus) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of ZMAT3 mRNA CTD PMID:14600272 and PMID:15890375 Zmat3 Mouse 4-acetylaminofluorene decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 4-acetylaminofluorene results in decreased expression of ZMAT3 mRNA CTD PMID:17070881 Zmat3 Mouse 4-hydroxynon-2-enal increases expression EXP 6480464 4-hydroxy-2-nonenal results in increased expression of ZMAT3 mRNA CTD PMID:19191707 Zmat3 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of ZMAT3 mRNA CTD PMID:28973697 Zmat3 Mouse 4-nitro-1,2-phenylenediamine increases expression ISO Zmat3 (Rattus norvegicus) 6480464 1 and 2-diamino-4-nitrobenzene results in increased expression of ZMAT3 mRNA CTD PMID:17070881 Zmat3 Mouse 5-aza-2'-deoxycytidine affects expression ISO ZMAT3 (Homo sapiens) 6480464 Decitabine affects the expression of ZMAT3 mRNA CTD PMID:23300844 Zmat3 Mouse 5-fluorouracil multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 TP53 protein promotes the reaction [Fluorouracil results in increased expression of ZMAT3 mRNA] CTD PMID:17982676 Zmat3 Mouse 5-fluorouracil increases expression ISO ZMAT3 (Homo sapiens) 6480464 Fluorouracil results in increased expression of ZMAT3 mRNA CTD PMID:17982676 Zmat3 Mouse 6-propyl-2-thiouracil increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of ZMAT3 mRNA CTD PMID:30047161 Zmat3 Mouse acetamide increases expression ISO Zmat3 (Rattus norvegicus) 6480464 acetamide results in increased expression of ZMAT3 mRNA CTD PMID:31881176 Zmat3 Mouse actinomycin D multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ZMAT3 mRNA CTD PMID:38460933 Zmat3 Mouse actinomycin D increases expression ISO ZMAT3 (Homo sapiens) 6480464 Dactinomycin results in increased expression of ZMAT3 mRNA CTD PMID:38460933 Zmat3 Mouse adefovir pivoxil increases expression ISO ZMAT3 (Homo sapiens) 6480464 adefovir dipivoxil results in increased expression of ZMAT3 mRNA CTD PMID:25596134 Zmat3 Mouse aflatoxin B1 affects expression ISO ZMAT3 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of ZMAT3 protein CTD PMID:20106945 Zmat3 Mouse aflatoxin B1 increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of ZMAT3 mRNA CTD PMID:15890375 more ... Zmat3 Mouse aflatoxin B1 increases expression ISO ZMAT3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of ZMAT3 mRNA CTD PMID:21641981 Zmat3 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ZMAT3 mRNA CTD PMID:19770486 Zmat3 Mouse amitrole increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Amitrole results in increased expression of ZMAT3 mRNA CTD PMID:30047161 Zmat3 Mouse ammonium chloride affects expression ISO Zmat3 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of ZMAT3 mRNA CTD PMID:16483693 Zmat3 Mouse amphetamine decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of ZMAT3 mRNA CTD PMID:30779732 Zmat3 Mouse arsane multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZMAT3 mRNA CTD PMID:39836092 Zmat3 Mouse arsenic atom multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZMAT3 mRNA CTD PMID:39836092 Zmat3 Mouse atrazine increases expression ISO ZMAT3 (Homo sapiens) 6480464 Atrazine results in increased expression of ZMAT3 mRNA CTD PMID:22378314 Zmat3 Mouse belinostat increases expression ISO ZMAT3 (Homo sapiens) 6480464 belinostat results in increased expression of ZMAT3 mRNA CTD PMID:27188386 Zmat3 Mouse benzene multiple interactions EXP 6480464 TRP53 protein affects the reaction [Benzene results in increased expression of ZMAT3 mRNA] CTD PMID:12928149 Zmat3 Mouse benzene increases expression EXP 6480464 Benzene results in increased expression of ZMAT3 mRNA and Benzene results in increased expression of ZMAT3 protein CTD PMID:12928149 more ... Zmat3 Mouse benzo[a]pyrene increases expression ISO ZMAT3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ZMAT3 mRNA CTD PMID:21632981 more ... Zmat3 Mouse benzo[a]pyrene increases methylation ISO ZMAT3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ZMAT3 promoter CTD PMID:27901495 Zmat3 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ZMAT3 mRNA and [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of ZMAT3 mRNA] CTD PMID:14625279 and PMID:27858113 Zmat3 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of ZMAT3 mRNA CTD PMID:14625279 more ... Zmat3 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO ZMAT3 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Zmat3 Mouse benzo[b]fluoranthene increases expression EXP 6480464 benzo(b)fluoranthene results in increased expression of ZMAT3 mRNA CTD PMID:26377693 Zmat3 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ZMAT3 mRNA CTD PMID:27858113 Zmat3 Mouse benzo[e]pyrene decreases methylation ISO ZMAT3 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of ZMAT3 intron CTD PMID:30157460 Zmat3 Mouse bicalutamide increases expression ISO ZMAT3 (Homo sapiens) 6480464 bicalutamide results in increased expression of ZMAT3 mRNA CTD PMID:15638997 Zmat3 Mouse bisphenol A affects expression ISO Zmat3 (Rattus norvegicus) 6480464 bisphenol A affects the expression of ZMAT3 mRNA CTD PMID:25181051 Zmat3 Mouse bisphenol A increases expression ISO ZMAT3 (Homo sapiens) 6480464 bisphenol A results in increased expression of ZMAT3 mRNA CTD PMID:33670352 Zmat3 Mouse bisphenol A increases expression ISO Zmat3 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of ZMAT3 mRNA CTD PMID:29097150 and PMID:34947998 Zmat3 Mouse bisphenol F multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ZMAT3 mRNA CTD PMID:28628672 Zmat3 Mouse butan-1-ol multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ZMAT3 mRNA CTD PMID:29432896 Zmat3 Mouse cadmium dichloride increases expression ISO ZMAT3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ZMAT3 mRNA CTD PMID:25596134 Zmat3 Mouse cadmium dichloride decreases expression ISO ZMAT3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ZMAT3 mRNA CTD PMID:38568856 Zmat3 Mouse camptothecin increases expression ISO ZMAT3 (Homo sapiens) 6480464 Camptothecin results in increased expression of ZMAT3 mRNA CTD PMID:38460933 Zmat3 Mouse carbamazepine affects expression ISO ZMAT3 (Homo sapiens) 6480464 Carbamazepine affects the expression of ZMAT3 mRNA CTD PMID:25979313 Zmat3 Mouse chloroacetaldehyde increases expression ISO ZMAT3 (Homo sapiens) 6480464 chloroacetaldehyde results in increased expression of ZMAT3 mRNA CTD PMID:25596134 Zmat3 Mouse chromium(6+) multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of ZMAT3 mRNA CTD PMID:38479592 Zmat3 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ZMAT3 mRNA CTD PMID:27858113 Zmat3 Mouse cidofovir anhydrous increases expression ISO ZMAT3 (Homo sapiens) 6480464 Cidofovir results in increased expression of ZMAT3 mRNA CTD PMID:25596134 Zmat3 Mouse cisplatin decreases expression ISO ZMAT3 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ZMAT3 mRNA CTD PMID:27594783 Zmat3 Mouse cisplatin increases expression ISO ZMAT3 (Homo sapiens) 6480464 Cisplatin results in increased expression of ZMAT3 mRNA CTD PMID:21532991 and PMID:25596134 Zmat3 Mouse cisplatin affects expression ISO ZMAT3 (Homo sapiens) 6480464 Cisplatin affects the expression of ZMAT3 mRNA CTD PMID:23300844 Zmat3 Mouse cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ZMAT3 mRNA CTD PMID:21151649 Zmat3 Mouse cisplatin multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of ZMAT3 mRNA CTD PMID:21858171 Zmat3 Mouse cobalt dichloride increases expression ISO ZMAT3 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ZMAT3 mRNA CTD PMID:19376846 Zmat3 Mouse copper atom multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of ZMAT3 mRNA CTD PMID:30911355 Zmat3 Mouse copper(0) multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of ZMAT3 mRNA CTD PMID:30911355 Zmat3 Mouse crocidolite asbestos increases expression EXP 6480464 Asbestos and Crocidolite results in increased expression of ZMAT3 mRNA CTD PMID:19446018 Zmat3 Mouse daunorubicin increases expression ISO ZMAT3 (Homo sapiens) 6480464 Daunorubicin results in increased expression of ZMAT3 mRNA CTD PMID:26537877 and PMID:28940058 Zmat3 Mouse dexamethasone multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ZMAT3 mRNA CTD PMID:28628672 Zmat3 Mouse diazinon affects expression ISO Zmat3 (Rattus norvegicus) 6480464 Diazinon affects the expression of ZMAT3 mRNA CTD PMID:22546817 Zmat3 Mouse dibenz[a,h]anthracene increases expression EXP 6480464 1 more ... CTD PMID:26377693 Zmat3 Mouse dieldrin affects expression ISO Zmat3 (Rattus norvegicus) 6480464 Dieldrin affects the expression of ZMAT3 mRNA CTD PMID:22546817 Zmat3 Mouse diethylstilbestrol increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Diethylstilbestrol results in increased expression of ZMAT3 mRNA CTD PMID:15890375 Zmat3 Mouse dioxygen decreases expression ISO ZMAT3 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of ZMAT3 mRNA CTD PMID:25596134 Zmat3 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ZMAT3 mRNA and [sulforaphane affects the susceptibility to Oxygen] which affects the expression of ZMAT3 mRNA CTD PMID:30529165 Zmat3 Mouse dorsomorphin multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Zmat3 Mouse doxorubicin increases expression ISO ZMAT3 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ZMAT3 mRNA CTD PMID:16439685 more ... Zmat3 Mouse doxorubicin affects expression ISO ZMAT3 (Homo sapiens) 6480464 Doxorubicin affects the expression of ZMAT3 mRNA CTD PMID:29803840 Zmat3 Mouse entinostat increases expression ISO ZMAT3 (Homo sapiens) 6480464 entinostat results in increased expression of ZMAT3 mRNA CTD PMID:27188386 Zmat3 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of ZMAT3 mRNA CTD PMID:30319688 Zmat3 Mouse ethyl methanesulfonate increases expression ISO ZMAT3 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of ZMAT3 mRNA CTD PMID:23649840 Zmat3 Mouse etoposide increases expression ISO ZMAT3 (Homo sapiens) 6480464 Etoposide results in increased expression of ZMAT3 mRNA CTD PMID:29397400 Zmat3 Mouse flavonoids increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Flavonoids results in increased expression of ZMAT3 mRNA CTD PMID:18035473 Zmat3 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZMAT3 mRNA CTD PMID:22206623 Zmat3 Mouse formaldehyde increases expression ISO ZMAT3 (Homo sapiens) 6480464 Formaldehyde results in increased expression of ZMAT3 mRNA CTD PMID:23649840 Zmat3 Mouse furan increases expression EXP 6480464 furan results in increased expression of ZMAT3 mRNA CTD PMID:24183702 Zmat3 Mouse gentamycin decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of ZMAT3 mRNA CTD PMID:33387578 Zmat3 Mouse ibuprofen increases expression ISO ZMAT3 (Homo sapiens) 6480464 Ibuprofen results in increased expression of ZMAT3 mRNA CTD PMID:25596134 Zmat3 Mouse ifosfamide increases expression ISO ZMAT3 (Homo sapiens) 6480464 Ifosfamide results in increased expression of ZMAT3 mRNA CTD PMID:25596134 Zmat3 Mouse indometacin multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ZMAT3 mRNA CTD PMID:28628672 Zmat3 Mouse iron dichloride increases expression ISO ZMAT3 (Homo sapiens) 6480464 ferrous chloride results in increased expression of ZMAT3 mRNA CTD PMID:35984750 Zmat3 Mouse leflunomide increases expression EXP 6480464 leflunomide results in increased expression of ZMAT3 mRNA CTD PMID:19751817 Zmat3 Mouse manganese atom multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZMAT3 mRNA CTD PMID:39836092 Zmat3 Mouse manganese(0) multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZMAT3 mRNA CTD PMID:39836092 Zmat3 Mouse manganese(II) chloride multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZMAT3 mRNA CTD PMID:39836092 Zmat3 Mouse mercury dibromide increases expression ISO ZMAT3 (Homo sapiens) 6480464 mercuric bromide results in increased expression of ZMAT3 mRNA CTD PMID:26272509 Zmat3 Mouse mercury dibromide multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ZMAT3 mRNA CTD PMID:27188386 Zmat3 Mouse methamphetamine affects response to substance EXP 6480464 ZMAT3 protein affects the susceptibility to Methamphetamine CTD PMID:17234339 Zmat3 Mouse methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of ZMAT3 protein CTD PMID:17234339 Zmat3 Mouse methamphetamine affects response to substance ISO Zmat3 (Rattus norvegicus) 6480464 ZMAT3 protein affects the susceptibility to Methamphetamine CTD PMID:17234339 Zmat3 Mouse methapyrilene increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Methapyrilene results in increased expression of ZMAT3 mRNA CTD PMID:15890375 Zmat3 Mouse methapyrilene decreases methylation ISO ZMAT3 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of ZMAT3 intron CTD PMID:30157460 Zmat3 Mouse methimazole increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Methimazole results in increased expression of ZMAT3 mRNA CTD PMID:30047161 Zmat3 Mouse methyl methanesulfonate increases expression ISO ZMAT3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ZMAT3 mRNA CTD PMID:23649840 Zmat3 Mouse methylmercury chloride increases expression ISO ZMAT3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ZMAT3 mRNA CTD PMID:23179753 more ... Zmat3 Mouse methylmercury chloride multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ZMAT3 mRNA CTD PMID:27188386 Zmat3 Mouse mitoxantrone increases expression ISO ZMAT3 (Homo sapiens) 6480464 Mitoxantrone results in increased expression of ZMAT3 mRNA CTD PMID:26537877 and PMID:28940058 Zmat3 Mouse N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ZMAT3 mRNA CTD PMID:21607683 Zmat3 Mouse N-nitrosodimethylamine increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Dimethylnitrosamine results in increased expression of ZMAT3 mRNA CTD PMID:14600272 and PMID:15890375 Zmat3 Mouse Nutlin-3 increases expression ISO ZMAT3 (Homo sapiens) 6480464 nutlin 3 results in increased expression of ZMAT3 mRNA and nutlin 3 results in increased expression of ZMAT3 protein CTD PMID:16439685 and PMID:38460933 Zmat3 Mouse Nutlin-3 multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of ZMAT3 mRNA CTD PMID:38460933 Zmat3 Mouse ochratoxin A increases expression ISO Zmat3 (Rattus norvegicus) 6480464 ochratoxin A results in increased expression of ZMAT3 mRNA CTD PMID:23358140 Zmat3 Mouse ochratoxin A decreases expression ISO ZMAT3 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of ZMAT3 mRNA CTD PMID:30559759 Zmat3 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of ZMAT3 mRNA CTD PMID:17562736 Zmat3 Mouse paracetamol increases expression ISO ZMAT3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ZMAT3 mRNA CTD PMID:22230336 and PMID:26690555 Zmat3 Mouse phenobarbital increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Phenobarbital results in increased expression of ZMAT3 mRNA CTD PMID:19162173 Zmat3 Mouse phenylmercury acetate increases expression ISO ZMAT3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ZMAT3 mRNA CTD PMID:26272509 Zmat3 Mouse phenylmercury acetate multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ZMAT3 mRNA CTD PMID:27188386 Zmat3 Mouse piperonyl butoxide increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Piperonyl Butoxide results in increased expression of ZMAT3 mRNA CTD PMID:15890375 Zmat3 Mouse pirinixic acid increases expression ISO Zmat3 (Rattus norvegicus) 6480464 pirinixic acid results in increased expression of ZMAT3 mRNA CTD PMID:15890375 Zmat3 Mouse piroxicam multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of ZMAT3 mRNA CTD PMID:21858171 Zmat3 Mouse potassium bromate increases expression ISO ZMAT3 (Homo sapiens) 6480464 potassium bromate results in increased expression of ZMAT3 mRNA CTD PMID:30559759 Zmat3 Mouse potassium chromate multiple interactions EXP 6480464 [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of ZMAT3 mRNA] CTD PMID:14625279 Zmat3 Mouse potassium dichromate multiple interactions EXP 6480464 [Potassium Dichromate co-treated with potassium chromate(VI)] inhibits the reaction [Benzo(a)pyrene results in increased expression of ZMAT3 mRNA] CTD PMID:14625279 Zmat3 Mouse pregnenolone 16alpha-carbonitrile increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in increased expression of ZMAT3 mRNA CTD PMID:19162173 Zmat3 Mouse quercetin increases expression ISO ZMAT3 (Homo sapiens) 6480464 Quercetin results in increased expression of ZMAT3 mRNA CTD PMID:21632981 Zmat3 Mouse resveratrol multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of ZMAT3 mRNA CTD PMID:23557933 Zmat3 Mouse Salinomycin decreases expression ISO ZMAT3 (Homo sapiens) 6480464 salinomycin results in decreased expression of ZMAT3 mRNA CTD PMID:19682730 Zmat3 Mouse SB 431542 multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Zmat3 Mouse silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of ZMAT3 mRNA CTD PMID:19073995 Zmat3 Mouse sodium arsenite increases expression ISO ZMAT3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ZMAT3 mRNA CTD PMID:38568856 Zmat3 Mouse sodium arsenite multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZMAT3 mRNA CTD PMID:39836092 Zmat3 Mouse sulfadimethoxine increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of ZMAT3 mRNA CTD PMID:30047161 Zmat3 Mouse sulforaphane decreases expression EXP 6480464 sulforaphane results in decreased expression of ZMAT3 mRNA CTD PMID:30529165 Zmat3 Mouse sulforaphane multiple interactions EXP 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of ZMAT3 mRNA CTD PMID:30529165 Zmat3 Mouse sunitinib increases expression ISO ZMAT3 (Homo sapiens) 6480464 Sunitinib results in increased expression of ZMAT3 mRNA CTD PMID:31533062 Zmat3 Mouse temozolomide decreases expression ISO ZMAT3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of ZMAT3 mRNA CTD PMID:31758290 Zmat3 Mouse testosterone decreases expression ISO ZMAT3 (Homo sapiens) 6480464 Testosterone results in decreased expression of ZMAT3 mRNA CTD PMID:33359661 Zmat3 Mouse tetrachloromethane decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of ZMAT3 mRNA CTD PMID:16644059 Zmat3 Mouse tetrachloromethane multiple interactions ISO Zmat3 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ZMAT3 mRNA] CTD PMID:31150632 Zmat3 Mouse tetrachloromethane increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of ZMAT3 mRNA CTD PMID:31150632 Zmat3 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ZMAT3 mRNA CTD PMID:27339419 and PMID:31919559 Zmat3 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ZMAT3 mRNA CTD PMID:27858113 Zmat3 Mouse thapsigargin increases expression ISO ZMAT3 (Homo sapiens) 6480464 Thapsigargin results in increased expression of ZMAT3 mRNA CTD PMID:22378314 Zmat3 Mouse thioacetamide increases expression ISO Zmat3 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of ZMAT3 mRNA CTD PMID:23411599 and PMID:34492290 Zmat3 Mouse tipifarnib increases expression ISO Zmat3 (Rattus norvegicus) 6480464 tipifarnib results in increased expression of ZMAT3 mRNA CTD PMID:16403772 Zmat3 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of ZMAT3 mRNA CTD PMID:29264374 Zmat3 Mouse trichostatin A increases expression ISO ZMAT3 (Homo sapiens) 6480464 trichostatin A results in increased expression of ZMAT3 mRNA CTD PMID:24935251 and PMID:26272509 Zmat3 Mouse trichostatin A multiple interactions ISO ZMAT3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ZMAT3 mRNA CTD PMID:27188386 Zmat3 Mouse triphenyl phosphate affects expression ISO ZMAT3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ZMAT3 mRNA CTD PMID:37042841 Zmat3 Mouse Triptolide increases expression EXP 6480464 triptolide results in increased expression of ZMAT3 mRNA CTD PMID:32835833 Zmat3 Mouse trovafloxacin increases expression EXP 6480464 trovafloxacin results in increased expression of ZMAT3 mRNA CTD PMID:35537566 Zmat3 Mouse tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of ZMAT3 mRNA CTD PMID:17127020 Zmat3 Mouse tunicamycin increases expression ISO ZMAT3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of ZMAT3 mRNA CTD PMID:22378314 Zmat3 Mouse urethane decreases expression ISO ZMAT3 (Homo sapiens) 6480464 Urethane results in decreased expression of ZMAT3 mRNA CTD PMID:28818685 Zmat3 Mouse valproic acid decreases expression ISO ZMAT3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ZMAT3 mRNA CTD PMID:29154799 Zmat3 Mouse valproic acid increases expression ISO ZMAT3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ZMAT3 mRNA CTD PMID:19101580 more ... Zmat3 Mouse valproic acid decreases methylation ISO ZMAT3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ZMAT3 gene CTD PMID:29154799 Zmat3 Mouse valproic acid affects expression ISO ZMAT3 (Homo sapiens) 6480464 Valproic Acid affects the expression of ZMAT3 mRNA CTD PMID:25979313 Zmat3 Mouse vinclozolin decreases expression ISO Zmat3 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of ZMAT3 mRNA CTD PMID:23034163 Zmat3 Mouse vincristine increases expression ISO ZMAT3 (Homo sapiens) 6480464 Vincristine results in increased expression of ZMAT3 mRNA CTD PMID:23649840 Zmat3 Mouse vorinostat increases expression ISO ZMAT3 (Homo sapiens) 6480464 vorinostat results in increased expression of ZMAT3 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) (-)-demecolcine (ISO) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 1-nitropropane (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-diaminotoluene (ISO) 2,4-dinitrotoluene (ISO) 2,6-diaminotoluene (ISO) 2-acetamidofluorene (EXP,ISO) 2-nitro-p-phenylenediamine (ISO) 2-nitrofluorene (ISO) 2-nitropropane (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (EXP) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 4-acetylaminofluorene (ISO) 4-hydroxynon-2-enal (EXP) 4-hydroxyphenyl retinamide (EXP) 4-nitro-1,2-phenylenediamine (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) actinomycin D (ISO) adefovir pivoxil (ISO) aflatoxin B1 (EXP,ISO) amitrole (ISO) ammonium chloride (ISO) amphetamine (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) belinostat (ISO) benzene (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (EXP) benzo[e]pyrene (ISO) bicalutamide (ISO) bisphenol A (ISO) bisphenol F (ISO) butan-1-ol (ISO) cadmium dichloride (ISO) camptothecin (ISO) carbamazepine (ISO) chloroacetaldehyde (ISO) chromium(6+) (ISO) chrysene (EXP) cidofovir anhydrous (ISO) cisplatin (EXP,ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (EXP) daunorubicin (ISO) dexamethasone (ISO) diazinon (ISO) dibenz[a,h]anthracene (EXP) dieldrin (ISO) diethylstilbestrol (ISO) dioxygen (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) etoposide (ISO) flavonoids (ISO) folic acid (EXP) formaldehyde (ISO) furan (EXP) gentamycin (ISO) ibuprofen (ISO) ifosfamide (ISO) indometacin (ISO) iron dichloride (ISO) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) methamphetamine (EXP,ISO) methapyrilene (ISO) methimazole (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mitoxantrone (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (ISO) Nutlin-3 (ISO) ochratoxin A (ISO) paracetamol (EXP,ISO) phenobarbital (ISO) phenylmercury acetate (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) piroxicam (ISO) potassium bromate (ISO) potassium chromate (EXP) potassium dichromate (EXP) pregnenolone 16alpha-carbonitrile (ISO) quercetin (ISO) resveratrol (ISO) Salinomycin (ISO) SB 431542 (ISO) silicon dioxide (EXP) sodium arsenite (ISO) sulfadimethoxine (ISO) sulforaphane (EXP) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetraphene (EXP) thapsigargin (ISO) thioacetamide (ISO) tipifarnib (ISO) titanium dioxide (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) trovafloxacin (EXP) tunicamycin (EXP,ISO) urethane (ISO) valproic acid (ISO) vinclozolin (ISO) vincristine (ISO) vorinostat (ISO)
Zmat3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 32,388,941 - 32,419,814 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 32,388,941 - 32,420,163 (-) Ensembl GRCm39 Ensembl GRCm38 3 32,334,792 - 32,365,665 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 32,334,792 - 32,366,014 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 32,233,714 - 32,264,587 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 32,526,345 - 32,557,169 (-) NCBI MGSCv36 mm8 Celera 3 32,246,614 - 32,279,808 (-) NCBI Celera Cytogenetic Map 3 A3 NCBI cM Map 3 15.67 NCBI
ZMAT3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 179,017,223 - 179,072,513 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 178,960,121 - 179,072,215 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 178,735,011 - 178,790,301 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 180,224,196 - 180,272,278 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 177,164,280 - 177,219,033 (-) NCBI Celera Cytogenetic Map 3 q26.32 NCBI HuRef 3 176,139,723 - 176,194,425 (-) NCBI HuRef CHM1_1 3 178,697,897 - 178,752,559 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 181,821,051 - 181,876,314 (-) NCBI T2T-CHM13v2.0
Zmat3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 117,034,517 - 117,066,141 (-) NCBI GRCr8 mRatBN7.2 2 115,106,046 - 115,136,888 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 115,106,966 - 115,136,863 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 121,720,010 - 121,750,776 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 119,832,639 - 119,863,404 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 114,533,608 - 114,564,419 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 118,715,229 - 118,746,109 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 118,721,334 - 118,745,766 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 138,381,017 - 138,411,897 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 118,526,985 - 118,537,727 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 118,471,951 - 118,482,689 (+) NCBI Celera 2 110,217,632 - 110,248,380 (-) NCBI Celera Cytogenetic Map 2 q24 NCBI
Zmat3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 8,274,395 - 8,298,224 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 8,270,026 - 8,301,313 (-) NCBI ChiLan1.0 ChiLan1.0
ZMAT3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 176,897,222 - 176,951,103 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 176,901,939 - 176,956,469 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 176,061,012 - 176,115,454 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 184,241,544 - 184,288,639 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 184,128,233 - 184,288,639 (-) Ensembl panpan1.1 panPan2
ZMAT3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 12,527,909 - 12,575,409 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 12,535,040 - 12,575,517 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 16,671,301 - 16,718,806 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 12,424,179 - 12,471,946 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 12,427,148 - 12,456,737 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 12,479,474 - 12,527,211 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 12,458,610 - 12,506,860 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 12,698,359 - 12,746,266 (-) NCBI UU_Cfam_GSD_1.0
Zmat3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 109,118,097 - 109,154,057 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936566 4,070,693 - 4,095,868 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936566 4,066,683 - 4,102,643 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZMAT3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 117,117,626 - 117,147,604 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 117,113,272 - 117,147,639 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 126,270,158 - 126,280,510 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZMAT3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 10,374,093 - 10,434,212 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 10,373,904 - 10,430,759 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 19,255,951 - 19,318,869 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zmat3
.
Predicted Target Of
Count of predictions: 4470 Count of miRNA genes: 865 Interacting mature miRNAs: 1140 Transcripts: ENSMUST00000029199, ENSMUST00000139660, ENSMUST00000168566 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 4141116 Lgaq4_m late growth adjusted QTL 4 (mouse) Not determined 10249221 83184946 Mouse 4141563 Lgq3_m late growth QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1357584 Splq6_m spleen weight QTL 6 (mouse) Not determined 3 10249221 83184946 Mouse 1301114 Ssial2_m susceptibility to sialadenitis 2 (mouse) Not determined 3 20174862 54180103 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 1300961 Bh4p_m bar holding four paws (mouse) Not determined 3 31837854 65837997 Mouse 4142092 Tgq13_m triglyceride QTL 13 (mouse) Not determined 18288168 52288168 Mouse 1357440 Hrtpq1_m heart weight percentage QTL 1 (mouse) Not determined 3 10249221 83184946 Mouse 4141255 W10q3_m weight 10 weeks QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1558925 Hivan1_m HIV-associated nephropathy 1 (mouse) Not determined 3 7586174 68716946 Mouse 39128206 Lwq18_m liver weight QTL 18 (mouse) 3 10249221 83184946 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 1300559 Thypr3_m thymocyte proliferative response 3 (mouse) Not determined 3 4525419 38525519 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 1301358 Eae20_m experimental allergic encephalomyelitis 20 (mouse) Not determined 3 11630453 45630591 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000029199 ⟹ ENSMUSP00000029199
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 32,388,941 - 32,419,827 (-) Ensembl GRCm38.p6 Ensembl 3 32,334,792 - 32,365,678 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000139660 ⟹ ENSMUSP00000141511
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 32,415,221 - 32,419,609 (-) Ensembl GRCm38.p6 Ensembl 3 32,361,072 - 32,365,460 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000168566 ⟹ ENSMUSP00000131317
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 32,388,945 - 32,419,769 (-) Ensembl GRCm38.p6 Ensembl 3 32,334,796 - 32,365,620 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000195055
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 32,416,351 - 32,420,163 (-) Ensembl GRCm38.p6 Ensembl 3 32,362,202 - 32,366,014 (-) Ensembl
RefSeq Acc Id:
NM_009517 ⟹ NP_033543
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 32,388,941 - 32,419,814 (-) NCBI GRCm38 3 32,334,792 - 32,365,665 (-) NCBI MGSCv37 3 32,233,714 - 32,264,587 (-) RGD Celera 3 32,246,614 - 32,279,808 (-) RGD cM Map 3 ENTREZGENE
Sequence:
GTCACTTCCTGCAGCTGTTTCCCGGTGGCTCCGCTCCGACCGACTTTTGACAATCAGCCTCCAGCAGCGGAGCGGCCGGTCGGCGGCGGCGAGCGCAGAAAGTGGTCTTGGAGCGGGCAGCGGCGCGC
hide sequence
RefSeq Acc Id:
XM_006535441 ⟹ XP_006535504
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 32,388,941 - 32,419,764 (-) NCBI GRCm38 3 32,334,792 - 32,365,615 (-) NCBI
Sequence:
CAATCAGCCTCCAGCAGCGGAGCGGCCGGTCGGCGGCGGCGAGCGCAGAAAGTGGTCTTGGAGCGGGCAGCGGCGCGCGGGGTGGCGGGGCGGCTGCGGCCTGCCGGTTCCGGTGAGTGCGGTCCTCG
hide sequence
RefSeq Acc Id:
NP_033543 ⟸ NM_009517
- UniProtKB:
O54836 (UniProtKB/Swiss-Prot), B9EI21 (UniProtKB/TrEMBL)
- Sequence:
MILLQQVWLPLPNRPSTSPPMSVAARSTRTLQLPPQKAFGQEASLPLAGEEDLAKRGEPDSALEELCKPLFCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARVSSVVAEPVATPLVPV
hide sequence
RefSeq Acc Id:
XP_006535504 ⟸ XM_006535441
- Peptide Label:
isoform X1
- UniProtKB:
O54836 (UniProtKB/Swiss-Prot), B9EI21 (UniProtKB/TrEMBL)
- Sequence:
MILLQQVWLPLPNRPSTSPPMSVAARSTRTLQLPPQKAFGQEASLPLAGEEDLAKRGEPDSALE
hide sequence
Ensembl Acc Id:
ENSMUSP00000141511 ⟸ ENSMUST00000139660
Ensembl Acc Id:
ENSMUSP00000029199 ⟸ ENSMUST00000029199
Ensembl Acc Id:
ENSMUSP00000131317 ⟸ ENSMUST00000168566
RGD ID: 6834644 Promoter ID: MM_KWN:33991 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, Brain, ES_Cell, Kidney, MEF_B4 Transcripts: OTTMUST00000052603, OTTMUST00000052604 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 32,264,129 - 32,264,629 (-) MPROMDB
RGD ID: 6880442 Promoter ID: EPDNEW_M3671 Type: initiation region Name: Zmat3_1 Description: Mus musculus zinc finger matrin type 3 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 32,365,662 - 32,365,722 EPDNEW
