Symbol:
Iars2
Name:
isoleucine-tRNA synthetase 2, mitochondrial
RGD ID:
1550834
MGI Page
MGI
Description:
Predicted to enable isoleucine-tRNA ligase activity. Predicted to be involved in isoleucyl-tRNA aminoacylation and mitochondrial translation. Located in mitochondrion. Is expressed in several structures, including alimentary system; genitourinary system; nervous system; respiratory system; and sensory organ. Orthologous to human IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2010002H18Rik; C79125; ileRS; isoleucine--tRNA ligase; isoleucine--tRNA ligase, mitochondrial; isoleucyl-tRNA synthetase, mitochondrial; MGC63429; RIKEN cDNA 2010002H18 gene
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Rattus norvegicus (Norway rat):
Iars2 (isoleucyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Iars2 (isoleucyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Iars2 (isoleucyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Iars2 (isoleucyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Iars2 (isoleucyl-tRNA synthetase 2, mitochondrial)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
IARS2 (isoleucyl-tRNA synthetase 2, mitochondrial)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
iars2 (isoleucyl-tRNA synthetase 2, mitochondrial)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ISM1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
IleRS-m
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
iars-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
iars2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 185,018,839 - 185,061,615 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 185,016,923 - 185,061,593 (-) Ensembl GRCm39 Ensembl GRCm38 1 185,286,642 - 185,329,419 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 185,284,726 - 185,329,396 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 187,110,541 - 187,153,280 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 186,987,450 - 187,030,189 (-) NCBI MGSCv36 mm8 Celera 1 192,244,078 - 192,279,032 (-) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 89.48 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Iars2 Mouse (+)-dexrazoxane multiple interactions EXP 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of IARS2 mRNA CTD PMID:26873546 Iars2 Mouse 17beta-estradiol affects expression ISO RGD:1311857 6480464 Estradiol affects the expression of IARS2 mRNA CTD PMID:32145629 Iars2 Mouse 2,3',4,4',5-Pentachlorobiphenyl decreases expression EXP 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of IARS2 mRNA CTD PMID:31388691 Iars2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of IARS2 mRNA CTD PMID:19465110|PMID:19770486 Iars2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1311857 6480464 Tetrachlorodibenzodioxin results in increased expression of IARS2 mRNA CTD PMID:32109520 Iars2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1311857 6480464 Tetrachlorodibenzodioxin results in decreased expression of IARS2 mRNA CTD PMID:22808131 Iars2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of IARS2 mRNA CTD PMID:21570461 Iars2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to IARS2 promoter] CTD PMID:19654925 Iars2 Mouse 2,4,6-trinitrotoluene affects expression ISO RGD:1311857 6480464 Trinitrotoluene affects the expression of IARS2 mRNA CTD PMID:21346803 Iars2 Mouse 2,6-dimethoxyphenol multiple interactions ISO RGD:1604336 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of IARS2 protein CTD PMID:38598786 Iars2 Mouse 2-amino-14,16-dimethyloctadecan-3-ol increases expression ISO RGD:1604336 6480464 2-amino-14,16-dimethyloctadecan-3-ol results in increased expression of IARS2 protein CTD PMID:32044396 Iars2 Mouse 2-hydroxypropanoic acid decreases expression ISO RGD:1604336 6480464 Lactic Acid results in decreased expression of IARS2 mRNA CTD PMID:30851411 Iars2 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1604336 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Iars2 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of IARS2 mRNA CTD PMID:39298647 Iars2 Mouse 4,4'-sulfonyldiphenol increases expression ISO RGD:1604336 6480464 bisphenol S results in increased expression of IARS2 protein CTD PMID:34186270 Iars2 Mouse 4-hydroxyphenyl retinamide affects expression ISO RGD:1604336 6480464 Fenretinide affects the expression of IARS2 mRNA CTD PMID:16570282 Iars2 Mouse actinomycin D multiple interactions ISO RGD:1604336 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of IARS2 protein CTD PMID:38460933 Iars2 Mouse all-trans-retinoic acid decreases expression ISO RGD:1604336 6480464 Tretinoin results in decreased expression of IARS2 mRNA CTD PMID:33167477 Iars2 Mouse amphetamine decreases expression ISO RGD:1311857 6480464 Amphetamine results in decreased expression of IARS2 mRNA CTD PMID:30779732 Iars2 Mouse aristolochic acid A decreases expression ISO RGD:1604336 6480464 aristolochic acid I results in decreased expression of IARS2 mRNA CTD PMID:33212167 Iars2 Mouse azoxystrobin increases expression ISO RGD:1604336 6480464 azoxystrobin results in increased expression of IARS2 mRNA CTD PMID:33512557 Iars2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of IARS2 mRNA CTD PMID:19770486 Iars2 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IARS2 mRNA CTD PMID:23798566 Iars2 Mouse bisphenol A increases expression ISO RGD:1604336 6480464 bisphenol A results in increased expression of IARS2 protein CTD PMID:37567409 Iars2 Mouse bisphenol A affects expression ISO RGD:1311857 6480464 bisphenol A affects the expression of IARS2 mRNA CTD PMID:32145629 Iars2 Mouse bisphenol A affects expression ISO RGD:1604336 6480464 bisphenol A affects the expression of IARS2 mRNA CTD PMID:30903817 Iars2 Mouse bisphenol AF increases expression ISO RGD:1604336 6480464 bisphenol AF results in increased expression of IARS2 protein CTD PMID:34186270 Iars2 Mouse bisphenol F multiple interactions ISO RGD:1604336 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Iars2 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of IARS2 mRNA CTD PMID:38685157 Iars2 Mouse Brodifacoum increases expression ISO RGD:1311857 6480464 bromfenacoum results in increased expression of IARS2 protein CTD PMID:28903499 Iars2 Mouse cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of IARS2 more ... CTD PMID:37325564 Iars2 Mouse cadmium dichloride decreases expression ISO RGD:1604336 6480464 Cadmium Chloride results in decreased expression of IARS2 mRNA CTD PMID:38568856 Iars2 Mouse cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of IARS2 more ... CTD PMID:37325564 Iars2 Mouse chloropicrin decreases expression ISO RGD:1604336 6480464 chloropicrin results in decreased expression of IARS2 mRNA CTD PMID:26352163 Iars2 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Iars2 Mouse cobalt dichloride decreases expression ISO RGD:1604336 6480464 cobaltous chloride results in decreased expression of IARS2 mRNA CTD PMID:19320972 Iars2 Mouse cyclosporin A decreases expression ISO RGD:1604336 6480464 Cyclosporine results in decreased expression of IARS2 mRNA CTD PMID:25562108 Iars2 Mouse dexamethasone multiple interactions ISO RGD:1604336 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Iars2 Mouse Dibutyl phosphate affects expression ISO RGD:1604336 6480464 di-n-butylphosphoric acid affects the expression of IARS2 mRNA CTD PMID:37042841 Iars2 Mouse diuron increases expression ISO RGD:1311857 6480464 Diuron results in increased expression of IARS2 mRNA CTD PMID:21551480 Iars2 Mouse doxorubicin multiple interactions EXP 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of IARS2 mRNA CTD PMID:26873546 Iars2 Mouse doxorubicin increases expression ISO RGD:1604336 6480464 Doxorubicin results in increased expression of IARS2 mRNA CTD PMID:29803840 Iars2 Mouse doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of IARS2 mRNA CTD PMID:26873546 Iars2 Mouse finasteride increases expression ISO RGD:1311857 6480464 Finasteride results in increased expression of IARS2 mRNA CTD PMID:24136188 Iars2 Mouse flutamide increases expression ISO RGD:1311857 6480464 Flutamide results in increased expression of IARS2 mRNA CTD PMID:24136188 Iars2 Mouse flutamide decreases expression ISO RGD:1311857 6480464 Flutamide results in decreased expression of IARS2 mRNA CTD PMID:24793618 Iars2 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Iars2 Mouse furfural multiple interactions ISO RGD:1604336 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of IARS2 protein CTD PMID:38598786 Iars2 Mouse glafenine decreases expression ISO RGD:1311857 6480464 Glafenine results in decreased expression of IARS2 mRNA CTD PMID:24136188 Iars2 Mouse indometacin multiple interactions ISO RGD:1604336 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Iars2 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of IARS2 mRNA CTD PMID:36331819 Iars2 Mouse ivermectin decreases expression ISO RGD:1604336 6480464 Ivermectin results in decreased expression of IARS2 protein CTD PMID:32959892 Iars2 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Iars2 Mouse leflunomide increases expression ISO RGD:1311857 6480464 leflunomide results in increased expression of IARS2 mRNA CTD PMID:24136188 Iars2 Mouse methyl methanesulfonate decreases expression ISO RGD:1604336 6480464 Methyl Methanesulfonate results in decreased expression of IARS2 mRNA CTD PMID:23649840 Iars2 Mouse nefazodone increases expression ISO RGD:1311857 6480464 nefazodone results in increased expression of IARS2 mRNA CTD PMID:24136188 Iars2 Mouse Nutlin-3 multiple interactions ISO RGD:1604336 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of IARS2 protein CTD PMID:38460933 Iars2 Mouse paracetamol decreases expression ISO RGD:1604336 6480464 Acetaminophen results in decreased expression of IARS2 mRNA CTD PMID:21420995|PMID:25704631|PMID:29067470|PMID:31059760 Iars2 Mouse pentachlorophenol decreases expression EXP 6480464 Pentachlorophenol results in decreased expression of IARS2 mRNA CTD PMID:23892564 Iars2 Mouse perfluorooctane-1-sulfonic acid increases expression ISO RGD:1604336 6480464 perfluorooctane sulfonic acid results in increased expression of IARS2 protein CTD PMID:24301089 Iars2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of IARS2 mRNA CTD PMID:36331819 Iars2 Mouse picoxystrobin increases expression ISO RGD:1604336 6480464 picoxystrobin results in increased expression of IARS2 mRNA CTD PMID:33512557 Iars2 Mouse rac-lactic acid decreases expression ISO RGD:1604336 6480464 Lactic Acid results in decreased expression of IARS2 mRNA CTD PMID:30851411 Iars2 Mouse resveratrol multiple interactions ISO RGD:1604336 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of IARS2 mRNA CTD PMID:23557933 Iars2 Mouse rotenone increases expression ISO RGD:1604336 6480464 Rotenone results in increased expression of IARS2 mRNA CTD PMID:33512557 Iars2 Mouse sodium arsenite decreases expression ISO RGD:1604336 6480464 sodium arsenite results in decreased expression of IARS2 mRNA CTD PMID:38568856 Iars2 Mouse sodium chloride multiple interactions ISO RGD:1604336 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of IARS2 protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Iars2 Mouse sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of IARS2 mRNA CTD PMID:31558096 Iars2 Mouse thiram decreases expression ISO RGD:1604336 6480464 Thiram results in decreased expression of IARS2 mRNA CTD PMID:38568856 Iars2 Mouse triphenyl phosphate affects expression ISO RGD:1604336 6480464 triphenyl phosphate affects the expression of IARS2 mRNA CTD PMID:37042841 Iars2 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of IARS2 mRNA CTD PMID:33045310 Iars2 Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of IARS2 mRNA CTD PMID:35537566 Iars2 Mouse uranium atom affects expression ISO RGD:1604336 6480464 Uranium affects the expression of IARS2 mRNA CTD PMID:15672453
Imported Annotations - KEGG (archival)
External Pathway Database Links
(+)-dexrazoxane (EXP) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (ISO) 2,6-dimethoxyphenol (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 2-hydroxypropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) actinomycin D (ISO) all-trans-retinoic acid (ISO) amphetamine (ISO) aristolochic acid A (ISO) azoxystrobin (ISO) benzo[a]pyrene (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) Brodifacoum (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) chloropicrin (ISO) choline (EXP) cobalt dichloride (ISO) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) diuron (ISO) doxorubicin (EXP,ISO) finasteride (ISO) flutamide (ISO) folic acid (EXP) furfural (ISO) glafenine (ISO) indometacin (ISO) inulin (EXP) ivermectin (ISO) L-methionine (EXP) leflunomide (ISO) methyl methanesulfonate (ISO) nefazodone (ISO) Nutlin-3 (ISO) paracetamol (ISO) pentachlorophenol (EXP) perfluorooctane-1-sulfonic acid (EXP,ISO) picoxystrobin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) thiram (ISO) triphenyl phosphate (ISO) triptonide (EXP) trovafloxacin (EXP) uranium atom (ISO)
External Pathway Database Links
1.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, etal., Development 2000 Apr;127(8):1737-49.
3.
MGDs mouse GO annotations
MGD data from the GO Consortium
4.
Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.
Mootha VK, etal., Cell 2003 Nov 26;115(5):629-40.
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Iars2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 185,018,839 - 185,061,615 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 185,016,923 - 185,061,593 (-) Ensembl GRCm39 Ensembl GRCm38 1 185,286,642 - 185,329,419 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 185,284,726 - 185,329,396 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 187,110,541 - 187,153,280 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 186,987,450 - 187,030,189 (-) NCBI MGSCv36 mm8 Celera 1 192,244,078 - 192,279,032 (-) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 89.48 NCBI
IARS2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 220,094,132 - 220,148,041 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 220,094,132 - 220,148,041 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 220,267,474 - 220,321,383 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 218,334,078 - 218,388,006 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 193,486,662 - 193,540,592 (+) NCBI Celera Cytogenetic Map 1 q41 NCBI HuRef 1 190,941,806 - 190,995,804 (+) NCBI HuRef CHM1_1 1 221,540,260 - 221,593,871 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 219,333,406 - 219,387,315 (+) NCBI T2T-CHM13v2.0
Iars2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 99,363,035 - 99,397,068 (-) NCBI GRCr8 mRatBN7.2 13 96,831,484 - 96,865,518 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 96,831,484 - 96,865,501 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 99,330,620 - 99,364,644 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 100,736,584 - 100,770,617 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 97,912,874 - 97,946,903 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 103,229,868 - 103,265,019 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 103,231,387 - 103,264,906 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 107,904,738 - 107,938,042 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 101,289,607 - 101,337,461 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 101,481,932 - 101,526,405 (-) NCBI Celera 13 96,346,977 - 96,378,913 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
Iars2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955520 3,485,816 - 3,520,549 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955520 3,485,816 - 3,521,035 (-) NCBI ChiLan1.0 ChiLan1.0
IARS2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 29,265,349 - 29,319,096 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 29,227,709 - 29,281,454 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 195,666,995 - 195,720,661 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 200,703,860 - 200,756,849 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 200,703,711 - 200,757,648 (+) Ensembl panpan1.1 panPan2
IARS2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 14,864,004 - 14,925,684 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 14,863,998 - 14,925,635 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 14,906,454 - 14,968,937 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 14,899,113 - 14,961,588 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 14,898,983 - 14,962,667 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 14,909,808 - 14,971,917 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 15,255,376 - 15,317,833 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 15,543,643 - 15,606,062 (+) NCBI UU_Cfam_GSD_1.0
Iars2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 56,808,716 - 56,864,241 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936650 2,056,921 - 2,112,767 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936650 2,056,921 - 2,112,487 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IARS2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 9,685,678 - 9,737,159 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 9,685,641 - 9,739,816 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 11,767,633 - 11,807,380 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IARS2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 9,414,316 - 9,485,542 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 9,414,711 - 9,485,429 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 9,713,779 - 9,791,538 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Iars2
.
Predicted Target Of
Count of predictions: 2047 Count of miRNA genes: 780 Interacting mature miRNAs: 1017 Transcripts: ENSMUST00000027921, ENSMUST00000110974, ENSMUST00000110975, ENSMUST00000131770, ENSMUST00000153211 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357620 Aaj1_m anxiety in A/J 1 (mouse) Not determined 1 180832317 191851043 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 1357692 Axtq1_m anxiety QTL 1 (mouse) Not determined 1 180832317 191851043 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse
RH126614
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 185,286,821 - 185,287,053 UniSTS GRCm38 MGSCv37 1 187,110,700 - 187,110,932 UniSTS GRCm37 Celera 1 192,244,241 - 192,244,473 UniSTS Cytogenetic Map 1 H5 UniSTS Whitehead/MRC_RH 1 2300.34 UniSTS
AW743433
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 185,285,304 - 185,285,529 UniSTS GRCm38 MGSCv37 1 187,109,183 - 187,109,408 UniSTS GRCm37 Celera 1 192,242,720 - 192,242,945 UniSTS Cytogenetic Map 1 H5 UniSTS Whitehead/MRC_RH 1 2309.25 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000027921 ⟹ ENSMUSP00000027921
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,016,923 - 185,061,593 (-) Ensembl GRCm38.p6 Ensembl 1 185,284,726 - 185,329,396 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000110974 ⟹ ENSMUSP00000106601
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,044,043 - 185,061,593 (-) Ensembl GRCm38.p6 Ensembl 1 185,311,846 - 185,329,396 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000110975 ⟹ ENSMUSP00000106603
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,027,235 - 185,061,593 (-) Ensembl GRCm38.p6 Ensembl 1 185,295,038 - 185,329,396 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000131770
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,017,766 - 185,020,479 (-) Ensembl GRCm38.p6 Ensembl 1 185,285,569 - 185,288,282 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000153211
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 185,053,380 - 185,061,593 (-) Ensembl GRCm38.p6 Ensembl 1 185,321,183 - 185,329,396 (-) Ensembl
RefSeq Acc Id:
NM_198653 ⟹ NP_941055
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,018,839 - 185,061,598 (-) NCBI GRCm38 1 185,286,642 - 185,329,401 (-) NCBI MGSCv37 1 187,110,541 - 187,153,280 (-) RGD Celera 1 192,244,078 - 192,279,032 (-) RGD cM Map 1 ENTREZGENE
Sequence:
GCCCCGGAGCGCGTGCGCAGTTCCTCGCCGCCGAGCTCTTCAAGGGTCTCTACCTTTAGGTACCGGGCGGCTGCCGTGGGCCGTGTGCGGAGGGCTCCGCCCGGCTCGTCCACCATGCACTGGGGGCT
hide sequence
RefSeq Acc Id:
XM_006497179 ⟹ XP_006497242
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,041,894 - 185,061,615 (-) NCBI GRCm38 1 185,309,697 - 185,329,419 (-) NCBI
Sequence:
CTTGCCCCGCCCCTTCCGCCCCGGAGCGCGTGCGCAGTTCCTCGCCGCCGAGCTCTTCAAGGGTCTCTACCTTTAGGTACCGGGCGGCTGCCGTGGGCCGTGTGCGGAGGGCTCCGCCCGGCTCGTCC
hide sequence
RefSeq Acc Id:
XM_006497180 ⟹ XP_006497243
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 185,041,894 - 185,061,615 (-) NCBI GRCm38 1 185,309,697 - 185,329,419 (-) NCBI
Sequence:
CTTGCCCCGCCCCTTCCGCCCCGGAGCGCGTGCGCAGTTCCTCGCCGCCGAGCTCTTCAAGGGTCTCTACCTTTAGGTACCGGGCGGCTGCCGTGGGCCGTGTGCGGAGGGCTCCGCCCGGCTCGTCC
hide sequence
RefSeq Acc Id:
NP_941055 ⟸ NM_198653
- Peptide Label:
precursor
- UniProtKB:
Q8BIP3 (UniProtKB/Swiss-Prot), Q8BIJ6 (UniProtKB/Swiss-Prot), Q8BIJ0 (UniProtKB/Swiss-Prot), Q3TKT8 (UniProtKB/Swiss-Prot)
- Sequence:
MHWGLCPRGPGAAAVAAAGSFWGPARLPSRLGCLGMTRRLVVRSVAGADSPQSSSKGGRYRDTVLLPQTSFPMKLLGRQQSDMELEIQQKCGFSELYSWQRERKVKTEFCLHDGPPYANGDPHVGHAL
hide sequence
RefSeq Acc Id:
XP_006497243 ⟸ XM_006497180
- Peptide Label:
isoform X1
- UniProtKB:
E9PWN3 (UniProtKB/TrEMBL), Q8BIL6 (UniProtKB/TrEMBL)
- Sequence:
MHWGLCPRGPGAAAVAAAGSFWGPARLPSRLGCLGMTRRLVVRSVAGADSPQSSSKGGRYRDTVLLPQTSFPMKLLGRQQSDMELEIQQKCGFSELYSWQRERKVKTEFCLHDGPPYANGDPHVGHAL
hide sequence
RefSeq Acc Id:
XP_006497242 ⟸ XM_006497179
- Peptide Label:
isoform X1
- UniProtKB:
E9PWN3 (UniProtKB/TrEMBL), Q8BIL6 (UniProtKB/TrEMBL)
- Sequence:
MHWGLCPRGPGAAAVAAAGSFWGPARLPSRLGCLGMTRRLVVRSVAGADSPQSSSKGGRYRDTV
hide sequence
Ensembl Acc Id:
ENSMUSP00000027921 ⟸ ENSMUST00000027921
Ensembl Acc Id:
ENSMUSP00000106603 ⟸ ENSMUST00000110975
Ensembl Acc Id:
ENSMUSP00000106601 ⟸ ENSMUST00000110974
RGD ID: 6876024 Promoter ID: EPDNEW_M1463 Type: initiation region Name: Iars2_1 Description: Mus musculus isoleucine-tRNA synthetase 2, mitochondrial , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 185,329,378 - 185,329,438 EPDNEW
RGD ID: 6817907 Promoter ID: MM_KWN:3220 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Lung Transcripts: OTTMUST00000051853 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 187,111,644 - 187,112,144 (-) MPROMDB
RGD ID: 6817903 Promoter ID: MM_KWN:3224 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000110975, OTTMUST00000051852, OTTMUST00000051855, UC007DZB.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 187,152,964 - 187,153,464 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Iars2
isoleucine-tRNA synthetase 2, mitochondrial
2010002H18Rik
RIKEN cDNA 2010002H18 gene
Symbol and/or name change
5135510 APPROVED
2024-08-21
2010002H18Rik
RIKEN cDNA 2010002H18 gene
Iars2
isoleucine-tRNA synthetase 2, mitochondrial
Symbol and/or name change
5135510 APPROVED
