Advanced Search (OLGA)

Gene: Kars1 (lysyl-tRNA synthetase 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Kars1

Name:

lysyl-tRNA synthetase 1

RGD ID:

1359653

Description:

Enables several functions, including ATP binding activity; lysine-tRNA ligase activity; and tRNA binding activity. Involved in several processes, including ERK1 and ERK2 cascade; diadenosine tetraphosphate biosynthetic process; and lysyl-tRNA aminoacylation. Located in cytoplasm and nucleus. Part of aminoacyl-tRNA synthetase multienzyme complex. Biomarker of sciatic neuropathy. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease recessive intermediate B and autosomal recessive nonsyndromic deafness 89. Orthologous to human KARS1 (lysyl-tRNA synthetase 1); PARTICIPATES IN aminoacyl-tRNA biosynthetic pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Kars; lysine--tRNA ligase; LysRS; lysyl-tRNA synthetase; MGC94484

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KARS1 (lysyl-tRNA synthetase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Kars1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Kars1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KARS1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KARS1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Kars1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KARS1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KARS1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Kars1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	EBPL (EBP like)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	KARS1 (lysyl-tRNA synthetase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Kars1 (lysyl-tRNA synthetase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	kars (lysyl-tRNA synthetase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	KRS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	LysRS	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	kars-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	kars1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Candidate Gene For:

Eau8

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	56,867,096 - 56,886,151 (-)	NCBI		GRCr8
mRatBN7.2	19	39,957,846 - 39,976,837 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	39,957,846 - 39,977,632 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	46,821,408 - 46,840,370 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	47,474,740 - 47,493,706 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	49,723,690 - 49,742,981 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	44,212,205 - 44,231,209 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	44,212,206 - 44,231,157 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	55,018,815 - 55,037,820 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	41,927,508 - 41,946,461 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	41,932,389 - 41,951,342 (-)	NCBI
Celera	19	39,318,292 - 39,337,236 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kars1	Rat	sciatic neuropathy		IEP		12910554	mRNA,protein:decreased expression:dorsal root ganglion:	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kars1	Rat	autosomal recessive nonsyndromic deafness		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Autosomal recessive nonsyndromic deafness	ClinVar	PMID:23596069\|PMID:25356970\|PMID:25741868\|PMID:28492532\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:31116475
Kars1	Rat	autosomal recessive nonsyndromic deafness 89		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Deafness, autosomal recessive 89	ClinVar	PMID:21181198\|PMID:21427441\|PMID:23596069\|PMID:23768514\|PMID:24033266\|PMID:24824130\|PMID:25356970\|PMID:25741868\|PMID:28492532\|PMID:28496994\|PMID:28887846\|PMID:29615062\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:31116475\|PMID:31192300\|PMID:32730690\|PMID:33260297\|PMID:34062854\|PMID:34172899
Kars1	Rat	Charcot-Marie-Tooth disease		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease	ClinVar	PMID:20920668\|PMID:28492532
Kars1	Rat	Charcot-Marie-Tooth disease recessive intermediate B		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: CHARCOT-MARIE-TOOTH NEUROPATHY, RECESSIVE INTERMEDIATE B \| ClinVar Annotator: match by more ...	ClinVar	PMID:20920668\|PMID:23596069\|PMID:24033266\|PMID:25356970\|PMID:25741868\|PMID:28492532\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:31116475
Kars1	Rat	DEAFNESS, CONGENITAL, AND ADULT-ONSET PROGRESSIVE LEUKOENCEPHALOPATHY		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Deafness, congenital, and adult-onset progressive leukoencephalopathy	ClinVar	PMID:21427441\|PMID:23596069\|PMID:25356970\|PMID:25741868\|PMID:28492532\|PMID:28887846\|PMID:29615062\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:31116475\|PMID:33260297
Kars1	Rat	Developmental Disabilities		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Global developmental delay	ClinVar	PMID:25741868\|PMID:28492532\|PMID:28496994\|PMID:33260297\|PMID:34172899
Kars1	Rat	genetic disease		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:23596069\|PMID:25356970\|PMID:25741868\|PMID:28492532\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:31116475\|PMID:31192300\|PMID:34172899
Kars1	Rat	Hearing Loss		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Hearing impairment \| ClinVar Annotator: match by term: Nonsyndromic Hearing more ...	ClinVar	PMID:23596069\|PMID:24033266\|PMID:25356970\|PMID:25741868\|PMID:26467025\|PMID:28492532\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:31116475
Kars1	Rat	Joubert syndrome 20		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Joubert syndrome 20	ClinVar	PMID:23012439\|PMID:23349226\|PMID:28492532
Kars1	Rat	leukodystrophy		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Leukodystrophy	ClinVar	PMID:25741868\|PMID:28492532\|PMID:28496994\|PMID:33260297\|PMID:34172899
Kars1	Rat	LEUKOENCEPHALOPATHY, PROGRESSIVE, INFANTILE-ONSET, WITH OR WITHOUT DEAFNESS		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: LEUKOENCEPHALOPATHY, PROGRESSIVE, INFANTILE-ONSET, WITH DEAFNESS \| ClinVar Annotator: match by more ...	ClinVar	PMID:21181198\|PMID:21427441\|PMID:23596069\|PMID:23768514\|PMID:24824130\|PMID:25330800\|PMID:25356970\|PMID:25741868\|PMID:26741492\|PMID:27243033\|PMID:28492532\|PMID:28887846\|PMID:29615062\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:30715177\|PMID:31116475\|PMID:31192300\|PMID:32730690\|PMID:33260297\|PMID:33942428\|PMID:34172899\|PMID:34732400\|PMID:36344503\|PMID:38980148\|PMID:39062730
Kars1	Rat	nonsyndromic deafness		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Nonsyndromic hearing loss and deafness	ClinVar	PMID:21181198\|PMID:23768514\|PMID:24824130\|PMID:25741868
Kars1	Rat	optic nerve disease		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Optic neuropathy	ClinVar	PMID:23596069\|PMID:25356970\|PMID:25741868\|PMID:28492532\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:31116475
Kars1	Rat	sensorineural hearing loss		ISO	RGD:1345099	8554872	ClinVar Annotator: match by term: Congenital sensorineural hearing impairment \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:23596069\|PMID:25356970\|PMID:25741868\|PMID:28492532\|PMID:28496994\|PMID:30252186\|PMID:30311386\|PMID:30369941\|PMID:31116475\|PMID:33260297\|PMID:33942428\|PMID:34172899

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kars1	Rat	autosomal recessive nonsyndromic deafness 89		ISO	RGD:1345099	7240710		OMIM
Kars1	Rat	Charcot-Marie-Tooth disease recessive intermediate B		ISO	RGD:1345099	7240710		OMIM
Kars1	Rat	DEAFNESS, CONGENITAL, AND ADULT-ONSET PROGRESSIVE LEUKOENCEPHALOPATHY		ISO	RGD:1345099	7240710		OMIM
Kars1	Rat	LEUKOENCEPHALOPATHY, PROGRESSIVE, INFANTILE-ONSET, WITH OR WITHOUT DEAFNESS		ISO	RGD:1345099	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kars1	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1550396	6480464	1,2-Dimethylhydrazine results in increased expression of KARS1 mRNA	CTD	PMID:22206623
Kars1	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1550396	6480464	Ethinyl Estradiol results in increased expression of KARS1 mRNA	CTD	PMID:17555576\|PMID:17942748
Kars1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1345099	6480464	Estradiol promotes the reaction [KARS1 protein binds to ESR1 protein]	CTD	PMID:27156127
Kars1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:1550396	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of KARS1 mRNA	CTD	PMID:30294300
Kars1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2,2',4,4'-tetrabromodiphenyl ether results in increased expression of KARS1 mRNA	CTD	PMID:27291303
Kars1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1550396	6480464	Tetrachlorodibenzodioxin results in increased expression of KARS1 mRNA	CTD	PMID:17942748
Kars1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of KARS1 mRNA	CTD	PMID:33387578
Kars1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1550396	6480464	Tetrachlorodibenzodioxin affects the expression of KARS1 mRNA	CTD	PMID:21570461
Kars1	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:1345099	6480464	[pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ...	CTD	PMID:38598786
Kars1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of KARS1 protein	CTD	PMID:34915118
Kars1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1550396	6480464	bisphenol S results in increased expression of KARS1 mRNA	CTD	PMID:31881267\|PMID:39298647
Kars1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of KARS1 mRNA	CTD	PMID:28959563
Kars1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1345099	6480464	Tretinoin results in decreased expression of KARS1 mRNA	CTD	PMID:33167477
Kars1	Rat	atrazine	increases expression	ISO	RGD:1345099	6480464	Atrazine results in increased expression of KARS1 mRNA	CTD	PMID:22378314
Kars1	Rat	benzatropine	multiple interactions	ISO	RGD:1345099	6480464	[Cuprizone co-treated with Benztropine] results in decreased expression of KARS1 protein	CTD	PMID:34122009
Kars1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of KARS1 gene	CTD	PMID:28505145
Kars1	Rat	bisphenol A	decreases expression	ISO	RGD:1345099	6480464	bisphenol A results in decreased expression of KARS1 protein	CTD	PMID:37567409
Kars1	Rat	bisphenol A	increases expression	ISO	RGD:1550396	6480464	bisphenol A results in increased expression of KARS1 mRNA	CTD	PMID:26063408
Kars1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of KARS1 mRNA	CTD	PMID:25181051
Kars1	Rat	caffeine	increases phosphorylation	ISO	RGD:1345099	6480464	Caffeine results in increased phosphorylation of KARS1 protein	CTD	PMID:35688186
Kars1	Rat	captan	decreases expression	ISO	RGD:1550396	6480464	Captan results in decreased expression of KARS1 mRNA	CTD	PMID:31558096
Kars1	Rat	carbon nanotube	increases expression	ISO	RGD:1550396	6480464	Nanotubes, Carbon analog results in increased expression of KARS1 mRNA	CTD	PMID:25554681
Kars1	Rat	chlorpyrifos	decreases expression	ISO	RGD:1550396	6480464	Chlorpyrifos results in decreased expression of KARS1 mRNA	CTD	PMID:37019170
Kars1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1345099	6480464	Copper Sulfate results in decreased expression of KARS1 mRNA	CTD	PMID:19549813
Kars1	Rat	Cuprizon	multiple interactions	ISO	RGD:1345099	6480464	[Cuprizone co-treated with Benztropine] results in decreased expression of KARS1 protein	CTD	PMID:34122009
Kars1	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of KARS1 mRNA	CTD	PMID:23914054
Kars1	Rat	doxorubicin	decreases expression	ISO	RGD:1345099	6480464	Doxorubicin results in decreased expression of KARS1 mRNA	CTD	PMID:29803840
Kars1	Rat	ethanol	decreases expression	EXP		6480464	Ethanol results in decreased expression of KARS1 protein	CTD	PMID:19609968
Kars1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of KARS1 mRNA	CTD	PMID:24136188
Kars1	Rat	folpet	decreases expression	ISO	RGD:1550396	6480464	folpet results in decreased expression of KARS1 mRNA	CTD	PMID:31558096
Kars1	Rat	furfural	multiple interactions	ISO	RGD:1345099	6480464	[pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ...	CTD	PMID:38598786
Kars1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of KARS1 protein	CTD	PMID:22061828
Kars1	Rat	ivermectin	decreases expression	ISO	RGD:1345099	6480464	Ivermectin results in decreased expression of KARS1 protein	CTD	PMID:32959892
Kars1	Rat	kojic acid	decreases expression	ISO	RGD:1345099	6480464	kojic acid results in decreased expression of KARS1 mRNA	CTD	PMID:16595896
Kars1	Rat	lead(0)	decreases expression	ISO	RGD:1345099	6480464	Lead results in decreased expression of KARS1 mRNA	CTD	PMID:19921347
Kars1	Rat	methidathion	increases expression	ISO	RGD:1550396	6480464	methidathion results in increased expression of KARS1 mRNA	CTD	PMID:34813904
Kars1	Rat	N-methyl-4-phenylpyridinium	decreases expression	ISO	RGD:1345099	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of KARS1 protein	CTD	PMID:24806433
Kars1	Rat	nitrates	multiple interactions	ISO	RGD:1550396	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of KARS1 more ...	CTD	PMID:35964746
Kars1	Rat	paracetamol	decreases expression	ISO	RGD:1345099	6480464	Acetaminophen results in decreased expression of KARS1 mRNA	CTD	PMID:21420995\|PMID:25704631
Kars1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of KARS1 mRNA	CTD	PMID:33387578
Kars1	Rat	pentachlorophenol	increases expression	ISO	RGD:1550396	6480464	Pentachlorophenol results in increased expression of KARS1 mRNA	CTD	PMID:23892564
Kars1	Rat	SB 431542	multiple interactions	ISO	RGD:1345099	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of KARS1 more ...	CTD	PMID:37664457
Kars1	Rat	sodium arsenite	decreases expression	ISO	RGD:1345099	6480464	sodium arsenite results in decreased expression of KARS1 mRNA	CTD	PMID:38568856
Kars1	Rat	sodium chloride	multiple interactions	ISO	RGD:1345099	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Kars1	Rat	tamoxifen	affects expression	ISO	RGD:1550396	6480464	Tamoxifen affects the expression of KARS1 mRNA	CTD	PMID:17555576
Kars1	Rat	tetrachloromethane	increases expression	ISO	RGD:1550396	6480464	Carbon Tetrachloride results in increased expression of KARS1 mRNA	CTD	PMID:31919559
Kars1	Rat	thifluzamide	decreases expression	ISO	RGD:1345099	6480464	thifluzamide results in decreased expression of KARS1 mRNA	CTD	PMID:33512557
Kars1	Rat	trimellitic anhydride	increases expression	ISO	RGD:1550396	6480464	trimellitic anhydride results in increased expression of KARS1 mRNA	CTD	PMID:19042947
Kars1	Rat	triptonide	increases expression	ISO	RGD:1550396	6480464	triptonide results in increased expression of KARS1 mRNA	CTD	PMID:33045310
Kars1	Rat	valproic acid	affects expression	ISO	RGD:1345099	6480464	Valproic Acid affects the expression of KARS1 mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kars1	Rat	basophil activation involved in immune response	involved_in	IMP		12793003	PMID:19524539	CAFA
Kars1	Rat	basophil activation involved in immune response	involved_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	basophil activation involved in immune response	involved_in	IBA	PANTHER:PTN002873036\|RGD:1359653\|UniProtKB:Q15046	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	basophil activation involved in immune response	involved_in	ISO	RGD:1345099	1624291	UniProtKB:Q5XIM7 PMID:19524539	RGD	PMID:19524539
Kars1	Rat	diadenosine tetraphosphate biosynthetic process		IDA		2303395		RGD
Kars1	Rat	diadenosine tetraphosphate biosynthetic process	involved_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	diadenosine tetraphosphate biosynthetic process	involved_in	IBA	PANTHER:PTN002873036\|RGD:1359653\|UniProtKB:Q15046	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	diadenosine tetraphosphate biosynthetic process	involved_in	IMP		12793003	PMID:19524539	CAFA
Kars1	Rat	diadenosine tetraphosphate biosynthetic process	involved_in	ISO	RGD:1345099	1624291	UniProtKB:Q5XIM7 PMID:19524539, PMID:23159739	RGD	PMID:19524539\|PMID:23159739
Kars1	Rat	diadenosine tetraphosphate biosynthetic process		IDA		2303396		RGD
Kars1	Rat	ERK1 and ERK2 cascade	involved_in	IMP		12793003	PMID:19524539	CAFA
Kars1	Rat	ERK1 and ERK2 cascade	involved_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	ERK1 and ERK2 cascade	involved_in	ISO	RGD:1345099	1624291	UniProtKB:Q5XIM7 PMID:19524539	RGD	PMID:19524539
Kars1	Rat	lysyl-tRNA aminoacylation		IDA		2303393		RGD
Kars1	Rat	lysyl-tRNA aminoacylation	involved_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	lysyl-tRNA aminoacylation	involved_in	IBA	PANTHER:PTN000502669\|RGD:1359653\|SGD:S000002444\|SGD:S000005017\|UniProtKB:P0A8N3\|UniProtKB:P0A8N5\|UniProtKB:P9WFU7\|UniProtKB:Q15046	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	lysyl-tRNA aminoacylation	involved_in	ISO	RGD:1345099	1624291	PMID:10952987, PMID:23159739, PMID:9278442	RGD	PMID:10952987\|PMID:23159739\|PMID:9278442
Kars1	Rat	lysyl-tRNA aminoacylation	involved_in	IDA		12911009	PMID:6315704	UniProt
Kars1	Rat	lysyl-tRNA aminoacylation	involved_in	IEA	InterPro:IPR002313\|InterPro:IPR018149\|InterPro:IPR034762	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kars1	Rat	lysyl-tRNA aminoacylation		IDA		2303394		RGD
Kars1	Rat	positive regulation of DNA-templated transcription	involved_in	IMP		12793003	PMID:19524539	CAFA
Kars1	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	RGD:1345099	1624291	UniProtKB:Q5XIM7 PMID:19524539	RGD	PMID:19524539
Kars1	Rat	positive regulation of inflammatory response to antigenic stimulus	involved_in	ISO	RGD:1345099	1624291	PMID:15851690	RGD	PMID:15851690
Kars1	Rat	positive regulation of inflammatory response to antigenic stimulus	involved_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	positive regulation of macrophage activation	involved_in	ISO	RGD:1345099	1624291	PMID:15851690	RGD	PMID:15851690
Kars1	Rat	positive regulation of macrophage activation	involved_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	positive regulation of macrophage activation	involved_in	IBA	PANTHER:PTN002873036\|UniProtKB:Q15046	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	response to X-ray		IDA		12910553		RGD
Kars1	Rat	translation	involved_in	IEA	UniProtKB-KW:KW-0648	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	tRNA aminoacylation for protein translation	involved_in	IEA	InterPro:IPR004364	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kars1	Rat	aminoacyl-tRNA synthetase multienzyme complex		IDA		2303393		RGD
Kars1	Rat	aminoacyl-tRNA synthetase multienzyme complex	part_of	IBA	FB:FBgn0027084\|MGI:1934754\|PANTHER:PTN001097557\|RGD:1359653\|UniProtKB:Q15046	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	aminoacyl-tRNA synthetase multienzyme complex	part_of	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	aminoacyl-tRNA synthetase multienzyme complex	part_of	IDA		12793003	PMID:19524539	CAFA
Kars1	Rat	aminoacyl-tRNA synthetase multienzyme complex	part_of	ISO	RGD:1345099	1624291	PMID:19131329	RGD	PMID:19131329
Kars1	Rat	aminoacyl-tRNA synthetase multienzyme complex	part_of	ISO	RGD:1550396	1624291	PMID:12060739	RGD	PMID:12060739
Kars1	Rat	aminoacyl-tRNA synthetase multienzyme complex		IDA		2303394		RGD
Kars1	Rat	aminoacyl-tRNA synthetase multienzyme complex		IDA		2303396		RGD
Kars1	Rat	cytoplasm	located_in	IEA	InterPro:IPR018149	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kars1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kars1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	cytoplasm	located_in	IDA		12793003	PMID:19524539	CAFA
Kars1	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN000502669\|RGD:1359653\|SGD:S000002444\|SGD:S000005017\|TAIR:locus:2092850\|UniProtKB:P0A8N3\|UniProtKB:P0A8N5\|UniProtKB:P0A8N7\|UniProtKB:Q15046\|UniProtKB:Q580G3\|UniProtKB:Q8ILS8	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	cytosol	located_in	ISO	RGD:1345099	1624291	PMID:19289464, PMID:23159739	RGD	PMID:19289464\|PMID:23159739
Kars1	Rat	cytosol	located_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kars1	Rat	cytosol	located_in	ISS	UniProtKB:Q15046	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Kars1	Rat	cytosol	located_in	ISO	RGD:1345099\|UniProtKB:Q15046-1\|UniProtKB:Q15046-2	1624291		RGD	GO_REF:0000052
Kars1	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kars1	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	extracellular space	located_in	ISO	RGD:1345099	1624291	PMID:15851690	RGD	PMID:15851690
Kars1	Rat	extracellular space	located_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	mitochondrion	located_in	ISO	RGD:1345099	1624291	PMID:10952987	RGD	PMID:10952987
Kars1	Rat	mitochondrion	located_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	mitochondrion	is_active_in	IBA	PANTHER:PTN001097557\|UniProtKB:Q15046	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	nucleus	located_in	ISO	RGD:1345099	1624291	PMID:23159739	RGD	PMID:23159739
Kars1	Rat	nucleus	located_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kars1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	nucleus	located_in	IDA		12793003	PMID:19524539	CAFA
Kars1	Rat	plasma membrane	located_in	ISO	RGD:1345099\|UniProtKB:Q15046-1\|UniProtKB:Q15046-2	1624291		RGD	GO_REF:0000052
Kars1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	plasma membrane	located_in	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kars1	Rat	amino acid binding		IDA		2303396	lysine	RGD
Kars1	Rat	amino acid binding		IDA		2303394	lysine	RGD
Kars1	Rat	amino acid binding		IDA		2303393	lysine	RGD
Kars1	Rat	aminoacyl-tRNA ligase activity	enables	IEA	InterPro:IPR004364	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kars1	Rat	aminoacyl-tRNA ligase activity	enables	IEA	UniProtKB-KW:KW-0030	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	ATP binding		IDA		2303396		RGD
Kars1	Rat	ATP binding	enables	IEA	InterPro:IPR002313\|InterPro:IPR004364\|InterPro:IPR018149\|InterPro:IPR034762	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kars1	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	ATP binding		IDA		2303394		RGD
Kars1	Rat	ATP binding		IDA		2303393		RGD
Kars1	Rat	ATP:ADP adenylyltransferase activity	enables	ISS	UniProtKB:Q15046	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Kars1	Rat	ATP:ADP adenylyltransferase activity	enables	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	ATP:ADP adenylyltransferase activity	enables	IBA	PANTHER:PTN002873036\|UniProtKB:Q15046	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	ATP:ADP adenylyltransferase activity	enables	ISO	RGD:1345099	1624291	PMID:23159739	RGD	PMID:23159739
Kars1	Rat	identical protein binding	enables	ISO	RGD:1345099	1624291	UniProtKB:Q15046 PMID:18272479, PMID:21536907, PMID:24212136	RGD	PMID:18272479\|PMID:21536907\|PMID:24212136
Kars1	Rat	identical protein binding	enables	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	ligase activity	enables	IEA	UniProtKB-KW:KW-0436	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	lysine-tRNA ligase activity		IDA		2303393		RGD
Kars1	Rat	lysine-tRNA ligase activity	enables	IEA	RHEA:20792	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Kars1	Rat	lysine-tRNA ligase activity	enables	IEA	EC:6.1.1.6	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Kars1	Rat	lysine-tRNA ligase activity	enables	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	lysine-tRNA ligase activity	enables	IBA	PANTHER:PTN000502669\|RGD:1359653\|SGD:S000002444\|SGD:S000005017\|TAIR:locus:2098348\|UniProtKB:P0A8N3\|UniProtKB:P0A8N5\|UniProtKB:Q15046	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	lysine-tRNA ligase activity	enables	ISO	RGD:1345099	1624291	PMID:10952987, PMID:23159739, PMID:9278442	RGD	PMID:10952987\|PMID:23159739\|PMID:9278442
Kars1	Rat	lysine-tRNA ligase activity	enables	IEA	InterPro:IPR002313\|InterPro:IPR018149\|InterPro:IPR034762	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kars1	Rat	lysine-tRNA ligase activity	enables	IDA		12911009	PMID:6315704	UniProt
Kars1	Rat	lysine-tRNA ligase activity		IDA		2303394		RGD
Kars1	Rat	nucleic acid binding	enables	IEA	InterPro:IPR004365	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kars1	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	nucleotide binding	enables	IEA	InterPro:IPR004364\|InterPro:IPR018149\|InterPro:IPR044136	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kars1	Rat	protein binding	enables	ISO	RGD:1345099	1624291	UniProtKB:A2RTX5\|UniProtKB:P00441\|UniProtKB:P07814\|UniProtKB:P08865\|UniProtKB:Q13155\|UniProtKB:Q15046 PMID:16189514, PMID:21220307, PMID:21536907, PMID:21900206, PMID:21988832, PMID:22386318, PMID:23159739, PMID:24212136, PMID:24312579, PMID:24983501, PMID:25416956, PMID:29997244, PMID:32296183, more ...	RGD	PMID:16189514\|PMID:21220307\|PMID:21536907\|PMID:21900206\|PMID:21988832\|PMID:22386318\|PMID:23159739\|PMID:24212136\|PMID:24312579\|PMID:24983501\|PMID:25416956\|PMID:29997244\|PMID:32296183\|PMID:32814053\|PMID:33961781
Kars1	Rat	protein binding	enables	ISO	RGD:1345099,UniProtKB:Q15046-1	1624291	UniProtKB:Q13155 PMID:31116475	RGD	PMID:31116475
Kars1	Rat	protein homodimerization activity	enables	ISO	RGD:1345099	1624291	UniProtKB:Q15046 PMID:23159739	RGD	PMID:23159739
Kars1	Rat	protein homodimerization activity	enables	IEA	UniProtKB:Q15046\|ensembl:ENSP00000303043	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kars1	Rat	scaffold protein binding	enables	ISO	RGD:1550396	1624291	UniProtKB:Q8R010 PMID:12060739	RGD	PMID:12060739
Kars1	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kars1	Rat	tRNA binding		IDA		2303393		RGD
Kars1	Rat	tRNA binding	enables	IBA	PANTHER:PTN000502669\|RGD:1359653	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kars1	Rat	tRNA binding		IDA		2303394		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kars1	Rat	aminoacyl-tRNA biosynthetic pathway		IEA		6907045		KEGG	rno:00970

BioCyc Pathways

tRNA charging

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Characterization of a homogeneous complex of arginyl- and lysyl-tRNA synthetase: zinc and adenosine 5'-phosphate dependent synthesis of diadenosine 5',5'''-P1,P4-tetraphosphate.	Hilderman RH Biochemistry. 1983 Sep 13;22(19):4353-7.
3.	Characterization of a homogeneous arginyl- and lysyl-tRNA synthetase complex isolated from rat liver. Kinetic mechanism for lysyl-tRNA synthetase.	Hilderman RH, etal., J Biol Chem. 1983 Nov 25;258(22):13592-6.
4.	Purification and characterization of lysyl-tRNA synthetase after dissociation of the particulate aminoacyl-tRNA synthetases from rat liver.	Johnson DL, etal., J Biol Chem. 1980 May 10;255(9):4362-6.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	Expression profile of aminoacyl-tRNA synthetases in dorsal root ganglion neurons after peripheral nerve injury.	Park BS, etal., J Mol Histol. 2015 Feb;46(1):115-22. doi: 10.1007/s10735-014-9601-4. Epub 2014 Dec 3.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	The human lysyl-tRNA synthetase gene encodes both the cytoplasmic and mitochondrial enzymes by means of an unusual alternative splicing of the primary transcript.	Tolkunova E, etal., J Biol Chem 2000 Nov 10;275(45):35063-9.
14.	Physical and biochemical characterization of a purified arginyl-tRNA synthetase-lysyl-tRNA-synthetase complex from rat liver.	Van Dang C, etal., Biochemistry. 1982 Apr 13;21(8):1959-66.
15.	[Study of the kinetics of thermoinactivation of lysyl-tRNA-synthetase from the liver of x-irradiated rats].	Verkhogliad IN, etal., Radiobiologiia. 1985 Mar-Apr;25(2):185-90.
16.	Synthesis of diadenosine 5',5''' -P1,P4-tetraphosphate by lysyl-tRNA synthetase and a multienzyme complex of aminoacyl-tRNA synthetases from rat liver.	Wahab SZ and Yang DC, J Biol Chem. 1985 May 10;260(9):5286-9.
17.	LysRS serves as a key signaling molecule in the immune response by regulating gene expression.	Yannay-Cohen N, etal., Mol Cell. 2009 Jun 12;34(5):603-11. doi: 10.1016/j.molcel.2009.05.019.

PMID:9278442	PMID:12060739	PMID:15851690	PMID:18272479	PMID:18614015	PMID:19131329	PMID:19289464	PMID:21536907	PMID:23159739	PMID:24212136

Kars1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	56,867,096 - 56,886,151 (-)	NCBI		GRCr8
mRatBN7.2	19	39,957,846 - 39,976,837 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	39,957,846 - 39,977,632 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	46,821,408 - 46,840,370 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	47,474,740 - 47,493,706 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	49,723,690 - 49,742,981 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	44,212,205 - 44,231,209 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	44,212,206 - 44,231,157 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	55,018,815 - 55,037,820 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	41,927,508 - 41,946,461 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	41,932,389 - 41,951,342 (-)	NCBI
Celera	19	39,318,292 - 39,337,236 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

KARS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	75,627,724 - 75,647,665 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	75,627,474 - 75,648,643 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	75,661,622 - 75,681,563 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	74,219,131 - 74,239,078 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	74,219,130 - 74,239,078	NCBI
Celera	16	59,955,969 - 59,975,930 (-)	NCBI		Celera
Cytogenetic Map	16	q23.1	NCBI
HuRef	16	61,415,299 - 61,435,262 (-)	NCBI		HuRef
CHM1_1	16	77,074,018 - 77,093,985 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	81,676,020 - 81,695,962 (-)	NCBI		T2T-CHM13v2.0

Kars1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	112,720,071 - 112,737,986 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	112,720,075 - 112,737,955 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	111,993,439 - 112,011,354 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	111,993,443 - 112,011,323 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	114,517,340 - 114,535,205 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	114,880,116 - 114,897,941 (-)	NCBI		MGSCv36	mm8
Celera	8	116,222,771 - 116,240,662 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	58.27	NCBI

Kars1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	1,924,523 - 1,940,552 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	1,924,523 - 1,939,777 (+)	NCBI	ChiLan1.0	ChiLan1.0

KARS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	85,345,486 - 85,365,514 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	91,268,093 - 91,288,098 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	56,196,867 - 56,216,909 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	75,544,996 - 75,565,947 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	75,545,002 - 75,565,043 (-)	Ensembl	panpan1.1		panPan2

KARS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	75,172,976 - 75,188,197 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	75,173,032 - 75,188,197 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	75,150,330 - 75,165,555 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	75,486,891 - 75,502,304 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	75,486,958 - 75,502,304 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	75,423,065 - 75,438,308 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	75,258,329 - 75,273,495 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	75,749,065 - 75,764,469 (+)	NCBI		UU_Cfam_GSD_1.0

Kars1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	35,277,014 - 35,294,415 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	24,292,876 - 24,312,076 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	24,294,699 - 24,312,051 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KARS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	12,056,571 - 12,073,748 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	12,057,475 - 12,073,749 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	11,898,371 - 11,914,646 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KARS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	61,113,215 - 61,133,093 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	61,113,213 - 61,132,995 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	14,926,869 - 14,946,419 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kars1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	11,337,529 - 11,353,797 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	11,337,505 - 11,354,950 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Kars1
434 total Variants

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
19	41943610	41943611	G	T	snv	ACI/EurMcwi (MCW), GH/OmrMcwi (MCW), FHL/EurMcwi (MCW)	View more Information

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
19	55034917	55034918	G	T	snv	ACI/EurMcwi (MCW), FHL/EurMcwi (MCW), GH/OmrMcwi (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	108
Interacting mature miRNAs:	115
Transcripts:	ENSRNOT00000046126
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat

RH144422

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	39,969,921 - 39,970,180 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	44,224,277 - 44,224,535	NCBI	Rnor6.0
Rnor_5.0	19	55,030,887 - 55,031,145	UniSTS	Rnor5.0
RGSC_v3.4	19	41,939,581 - 41,939,839	UniSTS	RGSC3.4
Celera	19	39,330,359 - 39,330,617	UniSTS
RH 3.4 Map	19	515.6	UniSTS
Cytogenetic Map	19	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001006967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000046126 ⟹ ENSRNOP00000044454

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	39,957,846 - 39,976,834 (-)	Ensembl
Rnor_6.0 Ensembl	19	44,212,206 - 44,231,157 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117076 ⟹ ENSRNOP00000080260

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	39,957,849 - 39,977,632 (-)	Ensembl

RefSeq Acc Id:

NM_001006967 ⟹ NP_001006968

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	56,867,096 - 56,886,083 (-)	NCBI
mRatBN7.2	19	39,957,846 - 39,976,837 (-)	NCBI
Rnor_6.0	19	44,212,205 - 44,231,157 (-)	NCBI
Rnor_5.0	19	55,018,815 - 55,037,820 (-)	NCBI
RGSC_v3.4	19	41,927,508 - 41,946,461 (-)	RGD
Celera	19	39,318,292 - 39,337,236 (-)	RGD

Sequence:

show sequence

GGCCACGCTGCGGGAGGGTGAAGTCAAATTGGATGGCGAGCCGAAACTAAGCAAGAAGTGGTGGTAATCATTAGTTCCAGGGTGTTCTGCCATGTTGATGCAAGCTGCTGTCAGGCTTGTTAGGGGGT
CCCTGCGCCAAACCTCATGGGCAGAATGGGGTCAGAGGGAACTTCGACTGGGCCAACTTGCTCCTTTCACAACGCTCCGCAAGGACAAGCCACTTTCTGATAGAAGAAGTGAGCTGAAGAGGCGTCTG
AAAGCTGAGAAGAAGCTGGCAGAGAAAGAGGCCAAGCAGAAAGAGCTCAGTGAAAAGCAGCTAAACCAGACGACTGCTGCTGCTGCCACCAACCATACTGCTGACAATGGTGTGGGTGCTGAAGAGGA
GACCCTGGACCCAAACCAATACTACAAGATCCGTAGTCAAGCTGTCCAGCAGCTGAAGGTCAGTGGGGAGGACCCGTACCCACACAAGTTCCATGTGGACATCTCACTCACTCAGTTCATCCAAGAAT
ACAGTCACCTGCAGCCTGGGGACCACCTGACTGACATCACCTTAAAAGTAGCAGGTCGCATCCACGCCAAGAGAGCCTCTGGGGGAAAGCTCATCTTCTATGACCTTCGAGGAGAGGGGGTCAAGTTA
CAAGTCATGGCCAACTCCAGGAATTATAAATCAGAGGAAGAATTCGTTCACATCAATAACAAACTGCGCAGGGGAGACATAATCGGAGTCGAGGGCAATCCCGGAAAAACCAAGAAGGGTGAGCTGAG
CATCGTCCCCCGGGAGATGACACTCCTGTCCCCCTGCTTGCACATGCTGCCTCATCTTCACTTCGGCCTCAAGGACAAGGAAACAAGGTATCGTCAGAGATACTTGGACTTGATACTGAACGACTTTG
TGAGGCAGAAGTTTATCATCCGCTCTAAGATCATCACATATATAAGAAGTTTCTTGGACGAGCTGGGATTCCTAGAGATCGAGACTCCCATGATGAACATCATCCCCGGGGGAGCTGTGGCCAAGCCT
TTCATCACCTACCACAACGAGCTGGACATGAACCTGTACATGAGAATTGCTCCAGAGCTCTACCACAAGATGCTGGTGGTTGGTGGCATTGACCGGGTTTATGAAATTGGGCGCCAGTTCCGGAACGA
AGGGATTGATTTGACTCACAATCCTGAGTTCACCACCTGTGAGTTCTACATGGCCTATGCAGACTATCATGACCTCATGGAAATCACAGAGAAGATGCTGTCAGGGATGGTGAGAAGCATCACAGGCA
GTTACAAGATCACCTATCACCCAGATGGGCCAGAAGGCCAAGCCTATGAGATTGACTTCACCCCACCCTTCCGAAGAATCAGCATGGTAGAAGAGCTTGAGAAGGTTCTGGGCGTGAAGCTGCCAGAA
ACCAGTCTCTTTGAGACCGAAGAAACTCGCAAAATTCTCGATGATATTTGTGTTGCAAGGGCTGTTGAATGCCCCCCACCTCGGACCACAGCCAGGCTCCTTGATAAGCTTGTGGGAGAGTTCCTCGA
AGTGACATGCATCAGCCCTACATTCATCTGTGATCACCCACAGATCATGAGTCCTCTGGCCAAATGGCACCGTTGCAAAGAGGGTCTAACTGAGCGCTTCGAGCTGTTTGTCATGAAGAAGGAAATAT
GCAATGCGTACACTGAGCTGAACGACCCCGTGCGGCAGAGACAACTGTTTGAAGAACAGGCCAAGGCCAAGGCTGCTGGTGACGATGAGGCCATGTTCATAGATGAGAACTTCTGTACTGCCCTGGAG
TACGGGCTGCCCCCAACAGCTGGCTGGGGCATGGGTATCGACCGAGTCACCATGTTTCTCACAGACTCCAACAATATCAAGGAAGTACTTCTCTTTCCTGCCATGAAGCCTGAAGACAAGAAGGAAAC
TGCAACAGCCACCGAGACCCCAGAAAGCACAGAGGCCAGCCCCTCTGTCTAGAAGACTATGCAACTATGGCCTTTGCGCTTGAGCAGCAGATCTGGTCTGAGGGAGGGAGGGGTTCCTGTGTGGTGCC
CGCCCACTGGACACTGCAGTCCAACCACCACAAGAGAGAAGAATTAAAGAATTTCTTTTTATTCCTTGTTACCAAATAAACCATTTCTCTCTTTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001399193 ⟹ NP_001386122

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	56,867,096 - 56,886,083 (-)	NCBI
mRatBN7.2	19	39,957,846 - 39,976,837 (-)	NCBI

RefSeq Acc Id:

XM_063277942 ⟹ XP_063134012

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	56,867,096 - 56,886,131 (-)	NCBI

RefSeq Acc Id:

XM_063277943 ⟹ XP_063134013

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	56,867,096 - 56,886,151 (-)	NCBI


Protein RefSeqs	NP_001006968	(Get FASTA)	NCBI Sequence Viewer
	NP_001386122	(Get FASTA)	NCBI Sequence Viewer
	XP_063134012	(Get FASTA)	NCBI Sequence Viewer
	XP_063134013	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83652	(Get FASTA)	NCBI Sequence Viewer
	EDL92601	(Get FASTA)	NCBI Sequence Viewer
	EDL92602	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000044454
	ENSRNOP00000044454.3
	ENSRNOP00000080260
GenBank Protein	Q5XIM7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001006968 ⟸ NM_001006967
- Peptide Label:	isoform 1
- UniProtKB:	Q5XIM7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLMQAAVRLVRGSLRQTSWAEWGQRELRLGQLAPFTTLRKDKPLSDRRSELKRRLKAEKKLAEKEAKQKELSEKQLNQTTAAAATNHTADNGVGAEEETLDPNQYYKIRSQAVQQLKVSGEDPYPHKF HVDISLTQFIQEYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFVHINNKLRRGDIIGVEGNPGKTKKGELSIVPREMTLLSPCLHMLPHLHFGLKDKETRY RQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITE KMLSGMVRSITGSYKITYHPDGPEGQAYEIDFTPPFRRISMVEELEKVLGVKLPETSLFETEETRKILDDICVARAVECPPPRTTARLLDKLVGEFLEVTCISPTFICDHPQIMSPLAKWHRCKEGLT ERFELFVMKKEICNAYTELNDPVRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVTMFLTDSNNIKEVLLFPAMKPEDKKETATATETPESTEASPSV hide sequence

Ensembl Acc Id:

ENSRNOP00000044454 ⟸ ENSRNOT00000046126

Ensembl Acc Id:

ENSRNOP00000080260 ⟸ ENSRNOT00000117076

RefSeq Acc Id:	NP_001386122 ⟸ NM_001399193
- Peptide Label:	isoform 2
- UniProtKB:	A0A8I5ZPX4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063134013 ⟸ XM_063277943
- Peptide Label:	isoform X2

Protein Domains

Aminoacyl-transfer RNA synthetases class-II family

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIM7-F1-model_v2	AlphaFold	Q5XIM7	1-626	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701158

Promoter ID:

EPDNEW_R11682

Type:

multiple initiation site

Name:

Kars_1

Description:

lysyl-tRNA synthetase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	44,231,169 - 44,231,229	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-5634	BioCyc
BioCyc Pathway	TRNA-CHARGING-PWY [tRNA charging]	BioCyc
BioCyc Pathway Image	TRNA-CHARGING-PWY	BioCyc
Ensembl Genes	ENSRNOG00000019456	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000046126	ENTREZGENE
	ENSRNOT00000046126.4	UniProtKB/Swiss-Prot
	ENSRNOT00000117076	ENTREZGENE
Gene3D-CATH	2.40.50.140	UniProtKB/Swiss-Prot
	Bira Bifunctional Protein, Domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7135143	IMAGE-MGC_LOAD
InterPro	aa-tRNA-synt_II	UniProtKB/Swiss-Prot
	aa-tRNA-synth_II	UniProtKB/Swiss-Prot
	aa-tRNA-synth_II/BPL/LPL	UniProtKB/Swiss-Prot
	Lys-tRNA-ligase_II	UniProtKB/Swiss-Prot
	Lys-tRNA-ligase_II_bac/euk	UniProtKB/Swiss-Prot
	Lys-tRNA-ligase_II_N	UniProtKB/Swiss-Prot
	Lys-tRNA-synth_II_C	UniProtKB/Swiss-Prot
	NA-bd_OB-fold	UniProtKB/Swiss-Prot
	NA-bd_OB_tRNA	UniProtKB/Swiss-Prot
KEGG Report	rno:292028	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94484	IMAGE-MGC_LOAD
NCBI Gene	292028	ENTREZGENE
PANTHER	LYSINE--TRNA LIGASE	UniProtKB/Swiss-Prot
	LYSYL-TRNA SYNTHETASE	UniProtKB/Swiss-Prot
Pfam	tRNA-synt_2	UniProtKB/Swiss-Prot
	tRNA_anti-codon	UniProtKB/Swiss-Prot
PhenoGen	Kars1	PhenoGen
PIRSF	LysRS2	UniProtKB/Swiss-Prot
PRINTS	TRNASYNTHLYS	UniProtKB/Swiss-Prot
PROSITE	AA_TRNA_LIGASE_II	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019456	RatGTEx
Superfamily-SCOP	SSF50249	UniProtKB/Swiss-Prot
	SSF55681	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZPX4	ENTREZGENE, UniProtKB/TrEMBL
	Q5XIM7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-10-14	Kars1	lysyl-tRNA synthetase 1	Kars	lysyl-tRNA synthetase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Kars	lysyl-tRNA synthetase			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Kars	lysyl-tRNA synthetase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways