Kars1 (lysyl-tRNA synthetase 1) - Rat Genome Database

Name: Kars1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Kars1 (lysyl-tRNA synthetase 1) Rattus norvegicus

Analyze

Symbol:

Kars1

Name:

lysyl-tRNA synthetase 1

RGD ID:

1359653

Description:

Enables anion binding activity; lysine-tRNA ligase activity; and tRNA binding activity. Involved in several processes, including ERK1 and ERK2 cascade; diadenosine tetraphosphate biosynthetic process; and lysyl-tRNA aminoacylation. Located in cytoplasm and nucleus. Part of aminoacyl-tRNA synthetase multienzyme complex. Biomarker of sciatic neuropathy. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease recessive intermediate B and autosomal recessive nonsyndromic deafness 89. Orthologous to human KARS1 (lysyl-tRNA synthetase 1); PARTICIPATES IN aminoacyl-tRNA biosynthetic pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Kars; lysine--tRNA ligase; LysRS; lysyl-tRNA synthetase; MGC94484

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KARS1 (lysyl-tRNA synthetase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Kars1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Kars1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KARS1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KARS1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Kars1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KARS1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KARS1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Kars1 (lysyl-tRNA synthetase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	EBPL (EBP like)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	KARS1 (lysyl-tRNA synthetase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Kars1 (lysyl-tRNA synthetase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	kars (lysyl-tRNA synthetase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	KRS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	LysRS	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	kars-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	kars1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Candidate Gene For:

Eau8

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	39,957,846 - 39,976,837 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	39,957,846 - 39,977,632 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	46,821,408 - 46,840,370 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	47,474,740 - 47,493,706 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	49,723,690 - 49,742,981 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	44,212,205 - 44,231,209 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	44,212,206 - 44,231,157 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	55,018,815 - 55,037,820 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	41,927,508 - 41,946,461 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	41,932,389 - 41,951,342 (-)	NCBI
Celera	19	39,318,292 - 39,337,236 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive nonsyndromic deafness 89 (ISO)

Charcot-Marie-Tooth disease (ISO)

Charcot-Marie-Tooth disease recessive intermediate B (ISO)

DEAFNESS, CONGENITAL, AND ADULT-ONSET PROGRESSIVE LEUKOENCEPHALOPATHY (ISO)

Developmental Disabilities (ISO)

genetic disease (ISO)

Hearing Loss (ISO)

hypomyelinating leukodystrophy (ISO)

Joubert syndrome 20 (ISO)

leukodystrophy (ISO)

LEUKOENCEPHALOPATHY, PROGRESSIVE, INFANTILE-ONSET, WITH OR WITHOUT DEAFNESS (ISO)

nonsyndromic deafness (ISO)

optic nerve disease (ISO)

sciatic neuropathy (IEP)

sensorineural hearing loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

atrazine (ISO)

benzatropine (ISO)

bisphenol A (EXP,ISO)

caffeine (ISO)

captan (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

copper(II) sulfate (ISO)

Cuprizon (ISO)

decabromodiphenyl ether (EXP)

doxorubicin (ISO)

ethanol (EXP)

flutamide (EXP)

folpet (ISO)

gentamycin (EXP)

ivermectin (ISO)

kojic acid (ISO)

lead(0) (ISO)

methidathion (ISO)

N-methyl-4-phenylpyridinium (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

thifluzamide (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

basophil activation involved in immune response (IBA,IMP,ISO)

diadenosine tetraphosphate biosynthetic process (IBA,IDA,IMP,ISO)

ERK1 and ERK2 cascade (IMP,ISO)

lysyl-tRNA aminoacylation (IBA,IDA,IEA,ISO)

positive regulation of DNA-templated transcription (IMP,ISO)

positive regulation of inflammatory response to antigenic stimulus (ISO)

positive regulation of macrophage activation (IBA,ISO)

response to X-ray (IDA)

Cellular Component

aminoacyl-tRNA synthetase multienzyme complex (IBA,IDA,ISO)

cytoplasm (IDA,IEA)

cytosol (IBA,ISO,ISS)

extracellular space (IBA,ISO)

mitochondrion (IBA,ISO)

nucleus (IBA,IDA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

amino acid binding (IDA)

ATP adenylyltransferase activity (IBA,ISO,ISS)

ATP binding (IDA,IEA)

identical protein binding (ISO)

lysine-tRNA ligase activity (IBA,IDA,IEA,ISO)

nucleic acid binding (IEA)

protein binding (ISO)

protein homodimerization activity (ISO)

scaffold protein binding (ISO)

tRNA binding (IBA,IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

aminoacyl-tRNA biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Characterization of a homogeneous complex of arginyl- and lysyl-tRNA synthetase: zinc and adenosine 5'-phosphate dependent synthesis of diadenosine 5',5'''-P1,P4-tetraphosphate.	Hilderman RH Biochemistry. 1983 Sep 13;22(19):4353-7.
3.	Characterization of a homogeneous arginyl- and lysyl-tRNA synthetase complex isolated from rat liver. Kinetic mechanism for lysyl-tRNA synthetase.	Hilderman RH, etal., J Biol Chem. 1983 Nov 25;258(22):13592-6.
4.	Purification and characterization of lysyl-tRNA synthetase after dissociation of the particulate aminoacyl-tRNA synthetases from rat liver.	Johnson DL, etal., J Biol Chem. 1980 May 10;255(9):4362-6.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	Expression profile of aminoacyl-tRNA synthetases in dorsal root ganglion neurons after peripheral nerve injury.	Park BS, etal., J Mol Histol. 2015 Feb;46(1):115-22. doi: 10.1007/s10735-014-9601-4. Epub 2014 Dec 3.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	The human lysyl-tRNA synthetase gene encodes both the cytoplasmic and mitochondrial enzymes by means of an unusual alternative splicing of the primary transcript.	Tolkunova E, etal., J Biol Chem 2000 Nov 10;275(45):35063-9.
14.	Physical and biochemical characterization of a purified arginyl-tRNA synthetase-lysyl-tRNA-synthetase complex from rat liver.	Van Dang C, etal., Biochemistry. 1982 Apr 13;21(8):1959-66.
15.	[Study of the kinetics of thermoinactivation of lysyl-tRNA-synthetase from the liver of x-irradiated rats].	Verkhogliad IN, etal., Radiobiologiia. 1985 Mar-Apr;25(2):185-90.
16.	Synthesis of diadenosine 5',5''' -P1,P4-tetraphosphate by lysyl-tRNA synthetase and a multienzyme complex of aminoacyl-tRNA synthetases from rat liver.	Wahab SZ and Yang DC, J Biol Chem. 1985 May 10;260(9):5286-9.
17.	LysRS serves as a key signaling molecule in the immune response by regulating gene expression.	Yannay-Cohen N, etal., Mol Cell. 2009 Jun 12;34(5):603-11. doi: 10.1016/j.molcel.2009.05.019.

Additional References at PubMed

PMID:9278442	PMID:12060739	PMID:15851690	PMID:18272479	PMID:18614015	PMID:19131329	PMID:19289464	PMID:21536907	PMID:23159739	PMID:24212136

Genomics

Comparative Map Data

Kars1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	39,957,846 - 39,976,837 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	39,957,846 - 39,977,632 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	46,821,408 - 46,840,370 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	47,474,740 - 47,493,706 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	49,723,690 - 49,742,981 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	44,212,205 - 44,231,209 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	44,212,206 - 44,231,157 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	55,018,815 - 55,037,820 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	41,927,508 - 41,946,461 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	41,932,389 - 41,951,342 (-)	NCBI
Celera	19	39,318,292 - 39,337,236 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

KARS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	75,627,724 - 75,647,665 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	75,627,474 - 75,648,643 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	75,661,622 - 75,681,563 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	74,219,131 - 74,239,078 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	74,219,130 - 74,239,078	NCBI
Celera	16	59,955,969 - 59,975,930 (-)	NCBI		Celera
Cytogenetic Map	16	q23.1	NCBI
HuRef	16	61,415,299 - 61,435,262 (-)	NCBI		HuRef
CHM1_1	16	77,074,018 - 77,093,985 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	81,676,020 - 81,695,962 (-)	NCBI		T2T-CHM13v2.0

Kars1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	112,720,071 - 112,737,986 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	112,720,075 - 112,737,955 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	111,993,439 - 112,011,354 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	111,993,443 - 112,011,323 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	114,517,340 - 114,535,205 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	114,880,116 - 114,897,941 (-)	NCBI		MGSCv36	mm8
Celera	8	116,222,771 - 116,240,662 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	58.27	NCBI

Kars1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	1,924,523 - 1,940,552 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	1,924,523 - 1,939,777 (+)	NCBI	ChiLan1.0	ChiLan1.0

KARS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	16	91,268,093 - 91,288,098 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	56,196,867 - 56,216,909 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	75,544,996 - 75,565,947 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	75,545,002 - 75,565,043 (-)	Ensembl	panpan1.1		panPan2

KARS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	75,172,976 - 75,188,197 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	75,173,032 - 75,188,197 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	75,150,330 - 75,165,555 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	75,486,891 - 75,502,304 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	75,486,958 - 75,502,304 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	75,423,065 - 75,438,308 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	75,258,329 - 75,273,495 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	75,749,065 - 75,764,469 (+)	NCBI		UU_Cfam_GSD_1.0

Kars1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	35,277,014 - 35,294,415 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	24,292,876 - 24,312,076 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936475	24,294,699 - 24,312,051 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KARS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	12,056,571 - 12,073,748 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	12,057,475 - 12,073,749 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	11,898,371 - 11,914,646 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KARS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	61,113,215 - 61,133,093 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	61,113,213 - 61,132,995 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	14,926,869 - 14,946,419 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kars1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	11,337,529 - 11,353,797 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	11,337,505 - 11,354,950 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Kars1
409 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	108
Interacting mature miRNAs:	115
Transcripts:	ENSRNOT00000046126
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum insulin level (CMO:0000358)	19	33838214	55283146	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat

Markers in Region

RH144422

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	39,969,921 - 39,970,180 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	44,224,277 - 44,224,535	NCBI	Rnor6.0
Rnor_5.0	19	55,030,887 - 55,031,145	UniSTS	Rnor5.0
RGSC_v3.4	19	41,939,581 - 41,939,839	UniSTS	RGSC3.4
Celera	19	39,330,359 - 39,330,617	UniSTS
RH 3.4 Map	19	515.6	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001006967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000046126 ⟹ ENSRNOP00000044454

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	39,957,846 - 39,976,834 (-)	Ensembl
Rnor_6.0 Ensembl	19	44,212,206 - 44,231,157 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117076 ⟹ ENSRNOP00000080260

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	39,957,849 - 39,977,632 (-)	Ensembl

RefSeq Acc Id:

NM_001006967 ⟹ NP_001006968

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	39,957,846 - 39,976,837 (-)	NCBI
Rnor_6.0	19	44,212,205 - 44,231,157 (-)	NCBI
Rnor_5.0	19	55,018,815 - 55,037,820 (-)	NCBI
RGSC_v3.4	19	41,927,508 - 41,946,461 (-)	RGD
Celera	19	39,318,292 - 39,337,236 (-)	RGD

Sequence:

show sequence

GGCCACGCTGCGGGAGGGTGAAGTCAAATTGGATGGCGAGCCGAAACTAAGCAAGAAGTGGTGG
TAATCATTAGTTCCAGGGTGTTCTGCCATGTTGATGCAAGCTGCTGTCAGGCTTGTTAGGGGGT
CCCTGCGCCAAACCTCATGGGCAGAATGGGGTCAGAGGGAACTTCGACTGGGCCAACTTGCTCC
TTTCACAACGCTCCGCAAGGACAAGCCACTTTCTGATAGAAGAAGTGAGCTGAAGAGGCGTCTG
AAAGCTGAGAAGAAGCTGGCAGAGAAAGAGGCCAAGCAGAAAGAGCTCAGTGAAAAGCAGCTAA
ACCAGACGACTGCTGCTGCTGCCACCAACCATACTGCTGACAATGGTGTGGGTGCTGAAGAGGA
GACCCTGGACCCAAACCAATACTACAAGATCCGTAGTCAAGCTGTCCAGCAGCTGAAGGTCAGT
GGGGAGGACCCGTACCCACACAAGTTCCATGTGGACATCTCACTCACTCAGTTCATCCAAGAAT
ACAGTCACCTGCAGCCTGGGGACCACCTGACTGACATCACCTTAAAAGTAGCAGGTCGCATCCA
CGCCAAGAGAGCCTCTGGGGGAAAGCTCATCTTCTATGACCTTCGAGGAGAGGGGGTCAAGTTA
CAAGTCATGGCCAACTCCAGGAATTATAAATCAGAGGAAGAATTCGTTCACATCAATAACAAAC
TGCGCAGGGGAGACATAATCGGAGTCGAGGGCAATCCCGGAAAAACCAAGAAGGGTGAGCTGAG
CATCGTCCCCCGGGAGATGACACTCCTGTCCCCCTGCTTGCACATGCTGCCTCATCTTCACTTC
GGCCTCAAGGACAAGGAAACAAGGTATCGTCAGAGATACTTGGACTTGATACTGAACGACTTTG
TGAGGCAGAAGTTTATCATCCGCTCTAAGATCATCACATATATAAGAAGTTTCTTGGACGAGCT
GGGATTCCTAGAGATCGAGACTCCCATGATGAACATCATCCCCGGGGGAGCTGTGGCCAAGCCT
TTCATCACCTACCACAACGAGCTGGACATGAACCTGTACATGAGAATTGCTCCAGAGCTCTACC
ACAAGATGCTGGTGGTTGGTGGCATTGACCGGGTTTATGAAATTGGGCGCCAGTTCCGGAACGA
AGGGATTGATTTGACTCACAATCCTGAGTTCACCACCTGTGAGTTCTACATGGCCTATGCAGAC
TATCATGACCTCATGGAAATCACAGAGAAGATGCTGTCAGGGATGGTGAGAAGCATCACAGGCA
GTTACAAGATCACCTATCACCCAGATGGGCCAGAAGGCCAAGCCTATGAGATTGACTTCACCCC
ACCCTTCCGAAGAATCAGCATGGTAGAAGAGCTTGAGAAGGTTCTGGGCGTGAAGCTGCCAGAA
ACCAGTCTCTTTGAGACCGAAGAAACTCGCAAAATTCTCGATGATATTTGTGTTGCAAGGGCTG
TTGAATGCCCCCCACCTCGGACCACAGCCAGGCTCCTTGATAAGCTTGTGGGAGAGTTCCTCGA
AGTGACATGCATCAGCCCTACATTCATCTGTGATCACCCACAGATCATGAGTCCTCTGGCCAAA
TGGCACCGTTGCAAAGAGGGTCTAACTGAGCGCTTCGAGCTGTTTGTCATGAAGAAGGAAATAT
GCAATGCGTACACTGAGCTGAACGACCCCGTGCGGCAGAGACAACTGTTTGAAGAACAGGCCAA
GGCCAAGGCTGCTGGTGACGATGAGGCCATGTTCATAGATGAGAACTTCTGTACTGCCCTGGAG
TACGGGCTGCCCCCAACAGCTGGCTGGGGCATGGGTATCGACCGAGTCACCATGTTTCTCACAG
ACTCCAACAATATCAAGGAAGTACTTCTCTTTCCTGCCATGAAGCCTGAAGACAAGAAGGAAAC
TGCAACAGCCACCGAGACCCCAGAAAGCACAGAGGCCAGCCCCTCTGTCTAGAAGACTATGCAA
CTATGGCCTTTGCGCTTGAGCAGCAGATCTGGTCTGAGGGAGGGAGGGGTTCCTGTGTGGTGCC
CGCCCACTGGACACTGCAGTCCAACCACCACAAGAGAGAAGAATTAAAGAATTTCTTTTTATTC
CTTGTTACCAAATAAACCATTTCTCTCTTTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001399193 ⟹ NP_001386122

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	39,957,846 - 39,976,837 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001006968	(Get FASTA)	NCBI Sequence Viewer
	NP_001386122	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83652	(Get FASTA)	NCBI Sequence Viewer
	EDL92601	(Get FASTA)	NCBI Sequence Viewer
	EDL92602	(Get FASTA)	NCBI Sequence Viewer
	Q5XIM7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001006968 ⟸ NM_001006967
- Peptide Label:	isoform 1
- UniProtKB:	Q5XIM7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLMQAAVRLVRGSLRQTSWAEWGQRELRLGQLAPFTTLRKDKPLSDRRSELKRRLKAEKKLAEK EAKQKELSEKQLNQTTAAAATNHTADNGVGAEEETLDPNQYYKIRSQAVQQLKVSGEDPYPHKF HVDISLTQFIQEYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNY KSEEEFVHINNKLRRGDIIGVEGNPGKTKKGELSIVPREMTLLSPCLHMLPHLHFGLKDKETRY RQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD MNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITE KMLSGMVRSITGSYKITYHPDGPEGQAYEIDFTPPFRRISMVEELEKVLGVKLPETSLFETEET RKILDDICVARAVECPPPRTTARLLDKLVGEFLEVTCISPTFICDHPQIMSPLAKWHRCKEGLT ERFELFVMKKEICNAYTELNDPVRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGW GMGIDRVTMFLTDSNNIKEVLLFPAMKPEDKKETATATETPESTEASPSV hide sequence

RefSeq Acc Id:

ENSRNOP00000044454 ⟸ ENSRNOT00000046126

RefSeq Acc Id:

ENSRNOP00000080260 ⟸ ENSRNOT00000117076

RefSeq Acc Id:	NP_001386122 ⟸ NM_001399193
- Peptide Label:	isoform 2
- UniProtKB:	A0A8I5ZPX4 (UniProtKB/TrEMBL)

Protein Domains

Aminoacyl-transfer RNA synthetases class-II family

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIM7-F1-model_v2	AlphaFold	Q5XIM7	1-626	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359653	AgrOrtholog
BioCyc Gene	G2FUF-5634	BioCyc
BioCyc Pathway	TRNA-CHARGING-PWY [tRNA charging]	BioCyc
Ensembl Genes	ENSRNOG00000019456	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000044454	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000080260	ENTREZGENE
	ENSRNOP00000080260.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000046126	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000117076	ENTREZGENE
	ENSRNOT00000117076.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.140	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7135143	IMAGE-MGC_LOAD
InterPro	aa-tRNA-synt_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	aa-tRNA-synth_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	aa-tRNA-synth_II/BPL/LPL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lys-tRNA-ligase_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lys-tRNA-ligase_II_bac/euk	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lys-tRNA-ligase_II_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lys-tRNA-synth_II_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NA-bd_OB-fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NA-bd_OB_tRNA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:292028	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94484	IMAGE-MGC_LOAD
NCBI Gene	292028	ENTREZGENE
PANTHER	LYSINE--TRNA LIGASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LYSYL-TRNA SYNTHETASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	tRNA-synt_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	tRNA_anti-codon	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Kars1	PhenoGen
PIRSF	LysRS2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	TRNASYNTHLYS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	AA_TRNA_LIGASE_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50249	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF55681	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZPX4	ENTREZGENE, UniProtKB/TrEMBL
	Q5XIM7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-10-14	Kars1	lysyl-tRNA synthetase 1	Kars	lysyl-tRNA synthetase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Kars	lysyl-tRNA synthetase			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Kars	lysyl-tRNA synthetase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)