Symbol:
TP53INP2
Name:
tumor protein p53 inducible nuclear protein 2
RGD ID:
1352381
HGNC Page
HGNC:16104
Description:
Predicted to enable ubiquitin binding activity. Involved in autophagosome assembly and positive regulation of DNA-templated transcription. Located in autophagosome; cytosol; and nucleus.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
C20orf110; diabetes and obesity regulated; diabetes and obesity-regulated; dJ1181N3.1; DKFZp434B2411; DKFZp434O0827; DOR; FLJ21759; FLJ23500; p53-inducible protein U; PIG-U; PIGU; PINH; tumor protein p53-inducible nuclear protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Trp53inp2 (transformation related protein 53 inducible nuclear protein 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tp53inp2 (tumor protein p53 inducible nuclear protein 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Tp53inp2 (tumor protein p53 inducible nuclear protein 2) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
TP53INP2 (tumor protein p53 inducible nuclear protein 2) NCBI
Ortholog
Canis lupus familiaris (dog):
TP53INP2 (tumor protein p53 inducible nuclear protein 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tp53inp2 (tumor protein p53 inducible nuclear protein 2) NCBI
Ortholog
Sus scrofa (pig):
TP53INP2 (tumor protein p53 inducible nuclear protein 2) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
TP53INP2 (tumor protein p53 inducible nuclear protein 2) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Tp53inp2 (tumor protein p53 inducible nuclear protein 2) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tp53inp2 (tumor protein p53 inducible nuclear protein 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Trp53inp2 (transformation related protein 53 inducible nuclear protein 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tp53inp2 (tumor protein p53 inducible nuclear protein 2)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|ZFIN)
Xenopus tropicalis (tropical clawed frog):
tp53inp2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
tp53inp2.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
tp53inp2.S
Alliance
DIOPT (Xenbase)
Drosophila melanogaster (fruit fly):
TP53INP
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 34,704,344 - 34,713,436 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 34,704,339 - 34,713,439 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 33,292,148 - 33,301,240 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 32,755,809 - 32,764,898 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 32,755,808 - 32,764,898 NCBI Celera 20 30,041,236 - 30,050,322 (+) NCBI Celera Cytogenetic Map 20 q11.22 NCBI HuRef 20 30,071,142 - 30,080,228 (+) NCBI HuRef CHM1_1 20 33,193,630 - 33,202,719 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 36,425,010 - 36,434,099 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
TP53INP2 Human (+)-schisandrin B multiple interactions ISO RGD:735085 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TP53INP2 mRNA] CTD PMID:31150632 TP53INP2 Human (1->4)-beta-D-glucan multiple interactions ISO RGD:1615099 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TRP53INP2 mRNA CTD PMID:36331819 TP53INP2 Human 1,2-dimethylhydrazine multiple interactions ISO RGD:735085 6480464 [APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in increased expression of TP53INP2 mRNA CTD PMID:27840820 TP53INP2 Human 1,2-dimethylhydrazine multiple interactions ISO RGD:1615099 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TRP53INP2 mRNA CTD PMID:22206623 TP53INP2 Human 1,2-dimethylhydrazine decreases expression ISO RGD:1615099 6480464 1,2-Dimethylhydrazine results in decreased expression of TRP53INP2 mRNA CTD PMID:22206623 TP53INP2 Human 17alpha-ethynylestradiol increases expression ISO RGD:1615099 6480464 Ethinyl Estradiol results in increased expression of TRP53INP2 mRNA CTD PMID:17942748 TP53INP2 Human 17alpha-ethynylestradiol multiple interactions ISO RGD:1615099 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TRP53INP2 mRNA CTD PMID:17942748 TP53INP2 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TP53INP2 mRNA CTD PMID:20106945 TP53INP2 Human 17beta-estradiol increases expression ISO RGD:735085 6480464 Estradiol results in increased expression of TP53INP2 mRNA CTD PMID:32145629|PMID:35192832 TP53INP2 Human 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of TP53INP2 mRNA CTD PMID:22574217 TP53INP2 Human 17beta-estradiol increases expression ISO RGD:1615099 6480464 Estradiol results in increased expression of TRP53INP2 mRNA CTD PMID:15289156|PMID:39298647 TP53INP2 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1615099 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TRP53INP2 mRNA CTD PMID:17942748 TP53INP2 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:735085 6480464 Tetrachlorodibenzodioxin results in increased expression of TP53INP2 mRNA CTD PMID:34747641 TP53INP2 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1615099 6480464 Tetrachlorodibenzodioxin results in decreased expression of TRP53INP2 mRNA CTD PMID:26290441|PMID:28922406 TP53INP2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1615099 6480464 Tetrachlorodibenzodioxin affects the expression of TRP53INP2 mRNA CTD PMID:21570461 TP53INP2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:735085 6480464 Tetrachlorodibenzodioxin affects the expression of TRP53INP2 mRNA CTD PMID:22298810 TP53INP2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TP53INP2 mRNA CTD PMID:22298810 TP53INP2 Human 2,6-dinitrotoluene affects expression ISO RGD:735085 6480464 2,6-dinitrotoluene affects the expression of TRP53INP2 mRNA CTD PMID:21346803 TP53INP2 Human 2-palmitoylglycerol increases expression EXP 6480464 2-palmitoylglycerol results in increased expression of TP53INP2 mRNA CTD PMID:37199045 TP53INP2 Human 3-methylcholanthrene decreases expression ISO RGD:1615099 6480464 Methylcholanthrene results in decreased expression of TRP53INP2 mRNA CTD PMID:20713471 TP53INP2 Human 4,4'-sulfonyldiphenol affects expression ISO RGD:1615099 6480464 bisphenol S affects the expression of TRP53INP2 mRNA CTD PMID:39298647 TP53INP2 Human 4,4'-sulfonyldiphenol multiple interactions ISO RGD:735085 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 TP53INP2 Human 4-hydroxyphenyl retinamide decreases expression ISO RGD:1615099 6480464 Fenretinide results in decreased expression of TP53INP2 mRNA CTD PMID:28973697 TP53INP2 Human 6-propyl-2-thiouracil decreases expression ISO RGD:735085 6480464 Propylthiouracil results in decreased expression of TP53INP2 mRNA CTD PMID:24780913 TP53INP2 Human 6-propyl-2-thiouracil increases expression ISO RGD:735085 6480464 Propylthiouracil results in increased expression of TP53INP2 mRNA CTD PMID:30047161 TP53INP2 Human actinomycin D multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TP53INP2 mRNA CTD PMID:38460933 TP53INP2 Human aflatoxin B1 affects expression EXP 6480464 Aflatoxin B1 affects the expression of TP53INP2 protein CTD PMID:20106945 TP53INP2 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of TP53INP2 gene CTD PMID:27153756 TP53INP2 Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of TP53INP2 mRNA CTD PMID:21632981|PMID:21641981 TP53INP2 Human aflatoxin B1 decreases expression ISO RGD:1615099 6480464 Aflatoxin B1 results in decreased expression of TRP53INP2 mRNA CTD PMID:19770486 TP53INP2 Human amitrole decreases expression ISO RGD:735085 6480464 Amitrole results in decreased expression of TP53INP2 mRNA CTD PMID:38685447 TP53INP2 Human amitrole increases expression ISO RGD:735085 6480464 Amitrole results in increased expression of TP53INP2 mRNA CTD PMID:30047161 TP53INP2 Human ammonium chloride affects expression ISO RGD:735085 6480464 Ammonium Chloride affects the expression of TRP53INP2 mRNA CTD PMID:16483693 TP53INP2 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of TP53INP2 mRNA CTD PMID:33212167 TP53INP2 Human arsane decreases expression EXP 6480464 Arsenic results in decreased expression of TP53INP2 mRNA CTD PMID:27838757 TP53INP2 Human arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of TP53INP2 mRNA CTD PMID:27838757 TP53INP2 Human benzene increases expression EXP 6480464 Benzene results in increased expression of TP53INP2 mRNA CTD PMID:19162166 TP53INP2 Human benzo[a]pyrene affects expression EXP 6480464 Benzo(a)pyrene affects the expression of TP53INP2 mRNA CTD PMID:20106945 TP53INP2 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of TP53INP2 mRNA CTD PMID:32234424 TP53INP2 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of TP53INP2 3' UTR CTD PMID:27901495 TP53INP2 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of TP53INP2 5' UTR; Benzo(a)pyrene results in decreased methylation of more ... CTD PMID:27901495 TP53INP2 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TP53INP2 mRNA CTD PMID:21632981 TP53INP2 Human benzo[a]pyrene multiple interactions ISO RGD:1615099 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of TRP53INP2 mRNA] CTD PMID:22228805 TP53INP2 Human benzo[a]pyrene increases expression ISO RGD:1615099 6480464 Benzo(a)pyrene results in increased expression of TRP53INP2 mRNA CTD PMID:22228805 TP53INP2 Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of TP53INP2 mRNA CTD PMID:19150397 TP53INP2 Human benzo[b]fluoranthene decreases expression ISO RGD:1615099 6480464 benzo(b)fluoranthene results in decreased expression of TRP53INP2 mRNA CTD PMID:26377693 TP53INP2 Human bisphenol A affects expression ISO RGD:735085 6480464 bisphenol A affects the expression of TP53INP2 mRNA CTD PMID:25181051|PMID:30903817 TP53INP2 Human bisphenol A multiple interactions ISO RGD:735085 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:31129395|PMID:36041667 TP53INP2 Human bisphenol F multiple interactions ISO RGD:735085 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 TP53INP2 Human C60 fullerene decreases expression ISO RGD:735085 6480464 fullerene C60 results in decreased expression of TP53INP2 mRNA CTD PMID:19167457 TP53INP2 Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TP53INP2 more ... CTD PMID:35301059 TP53INP2 Human cadmium dichloride increases expression ISO RGD:735085 6480464 Cadmium Chloride results in increased expression of TP53INP2 mRNA CTD PMID:33453195 TP53INP2 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TP53INP2 more ... CTD PMID:35301059 TP53INP2 Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of TP53INP2 mRNA CTD PMID:21592394 TP53INP2 Human calcitriol multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TP53INP2 mRNA CTD PMID:21592394 TP53INP2 Human camptothecin increases expression EXP 6480464 Camptothecin results in increased expression of TP53INP2 mRNA CTD PMID:38460933 TP53INP2 Human capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of TP53INP2 mRNA CTD PMID:36044967 TP53INP2 Human captan decreases expression ISO RGD:1615099 6480464 Captan results in decreased expression of TRP53INP2 mRNA CTD PMID:31558096 TP53INP2 Human carbon nanotube decreases expression ISO RGD:1615099 6480464 Nanotubes, Carbon analog results in decreased expression of TRP53INP2 mRNA CTD PMID:25554681 TP53INP2 Human carbon nanotube increases expression ISO RGD:1615099 6480464 Nanotubes, Carbon results in increased expression of TRP53INP2 mRNA CTD PMID:25620056 TP53INP2 Human chlordecone increases expression ISO RGD:1615099 6480464 Chlordecone results in increased expression of TRP53INP2 mRNA CTD PMID:29980752 TP53INP2 Human clofibrate multiple interactions ISO RGD:1615099 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TRP53INP2 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 TP53INP2 Human cobalt dichloride decreases expression ISO RGD:735085 6480464 cobaltous chloride results in decreased expression of TP53INP2 mRNA CTD PMID:24386269 TP53INP2 Human cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of TP53INP2 mRNA CTD PMID:15009677 TP53INP2 Human copper atom multiple interactions ISO RGD:1615099 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ... CTD PMID:15467011 TP53INP2 Human copper(0) multiple interactions ISO RGD:1615099 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ... CTD PMID:15467011 TP53INP2 Human coumestrol decreases expression EXP 6480464 Coumestrol results in decreased expression of TP53INP2 mRNA CTD PMID:19167446 TP53INP2 Human crocidolite asbestos decreases expression ISO RGD:1615099 6480464 Asbestos, Crocidolite results in decreased expression of TRP53INP2 mRNA CTD PMID:29279043 TP53INP2 Human Cuprizon decreases expression ISO RGD:735085 6480464 Cuprizone results in decreased expression of TP53INP2 mRNA CTD PMID:27523638 TP53INP2 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of TP53INP2 mRNA CTD PMID:20106945|PMID:27989131 TP53INP2 Human cyclosporin A affects expression EXP 6480464 Cyclosporine affects the expression of TP53INP2 mRNA CTD PMID:25562108 TP53INP2 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of TP53INP2 mRNA CTD PMID:38568856 TP53INP2 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of TP53INP2 mRNA CTD PMID:37042841 TP53INP2 Human dibutyl phthalate increases expression ISO RGD:735085 6480464 Dibutyl Phthalate results in increased expression of TRP53INP2 mRNA CTD PMID:21266533 TP53INP2 Human dicrotophos increases expression EXP 6480464 dicrotophos results in increased expression of TP53INP2 mRNA CTD PMID:28302478 TP53INP2 Human diethylstilbestrol increases expression ISO RGD:1615099 6480464 Diethylstilbestrol results in increased expression of TRP53INP2 mRNA CTD PMID:15289156 TP53INP2 Human dioxygen multiple interactions ISO RGD:1615099 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TRP53INP2 mRNA CTD PMID:30529165 TP53INP2 Human diuron decreases expression ISO RGD:735085 6480464 Diuron results in decreased expression of TP53INP2 mRNA CTD PMID:21551480 TP53INP2 Human Doramectin decreases expression ISO RGD:735085 6480464 doramectin results in decreased expression of TP53INP2 mRNA CTD PMID:35137919 TP53INP2 Human endosulfan decreases expression ISO RGD:735085 6480464 Endosulfan results in decreased expression of TP53INP2 mRNA CTD PMID:29391264 TP53INP2 Human epoxiconazole affects expression ISO RGD:1615099 6480464 epoxiconazole affects the expression of TRP53INP2 mRNA CTD PMID:35436446 TP53INP2 Human ethanol increases expression ISO RGD:1615099 6480464 Ethanol results in increased expression of TRP53INP2 mRNA CTD PMID:30319688 TP53INP2 Human ethyl methanesulfonate increases expression EXP 6480464 Ethyl Methanesulfonate results in increased expression of TP53INP2 mRNA CTD PMID:23649840 TP53INP2 Human fenthion decreases expression ISO RGD:1615099 6480464 Fenthion results in decreased expression of TRP53INP2 mRNA CTD PMID:34813904 TP53INP2 Human flutamide decreases expression ISO RGD:735085 6480464 Flutamide results in decreased expression of TP53INP2 mRNA CTD PMID:24136188 TP53INP2 Human folic acid multiple interactions ISO RGD:1615099 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TRP53INP2 mRNA CTD PMID:22206623 TP53INP2 Human folpet decreases expression ISO RGD:1615099 6480464 folpet results in decreased expression of TRP53INP2 mRNA CTD PMID:31558096 TP53INP2 Human formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of TP53INP2 mRNA CTD PMID:23649840 TP53INP2 Human genistein increases expression ISO RGD:1615099 6480464 Genistein results in increased expression of TRP53INP2 mRNA CTD PMID:15289156 TP53INP2 Human genistein decreases expression EXP 6480464 Genistein results in decreased expression of TP53INP2 mRNA CTD PMID:26865667 TP53INP2 Human gentamycin increases expression ISO RGD:735085 6480464 Gentamicins results in increased expression of TP53INP2 mRNA CTD PMID:33387578 TP53INP2 Human inulin multiple interactions ISO RGD:1615099 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TRP53INP2 mRNA CTD PMID:36331819 TP53INP2 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TP53INP2 mRNA CTD PMID:35811015 TP53INP2 Human lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of TP53INP2 mRNA CTD PMID:35811015 TP53INP2 Human methapyrilene decreases expression ISO RGD:735085 6480464 Methapyrilene results in decreased expression of TP53INP2 mRNA CTD PMID:30467583 TP53INP2 Human methidathion decreases expression ISO RGD:1615099 6480464 methidathion results in decreased expression of TRP53INP2 mRNA CTD PMID:34813904 TP53INP2 Human methimazole increases expression ISO RGD:735085 6480464 Methimazole results in increased expression of TP53INP2 mRNA CTD PMID:30047161 TP53INP2 Human methyl methanesulfonate increases expression EXP 6480464 Methyl Methanesulfonate results in increased expression of TP53INP2 mRNA CTD PMID:23649840 TP53INP2 Human mono(2-ethylhexyl) phthalate decreases expression ISO RGD:1615099 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of TRP53INP2 mRNA CTD PMID:22401849 TP53INP2 Human N-methyl-4-phenylpyridinium decreases expression ISO RGD:735085 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of TP53INP2 mRNA CTD PMID:28801915 TP53INP2 Human nefazodone decreases expression ISO RGD:735085 6480464 nefazodone results in decreased expression of TP53INP2 mRNA CTD PMID:24136188 TP53INP2 Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of TP53INP2 mRNA CTD PMID:25583101 TP53INP2 Human Nutlin-3 multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of TP53INP2 mRNA CTD PMID:38460933 TP53INP2 Human okadaic acid increases expression EXP 6480464 Okadaic Acid results in increased expression of TP53INP2 mRNA CTD PMID:38832940 TP53INP2 Human oxaliplatin multiple interactions ISO RGD:735085 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TP53INP2 mRNA CTD PMID:25729387 TP53INP2 Human ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of TP53INP2 mRNA CTD PMID:35430440 TP53INP2 Human Pachymic acid multiple interactions EXP 6480464 pachymic acid promotes the reaction [TP53INP2 protein binds to CASP8 protein]; TP53INP2 protein promotes the more ... CTD PMID:38560766 TP53INP2 Human Pachymic acid increases expression EXP 6480464 pachymic acid results in increased expression of TP53INP2 protein CTD PMID:38560766 TP53INP2 Human paracetamol multiple interactions ISO RGD:1615099 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TRP53INP2 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 TP53INP2 Human paracetamol increases expression ISO RGD:735085 6480464 Acetaminophen results in increased expression of TP53INP2 mRNA CTD PMID:33387578 TP53INP2 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TP53INP2 mRNA CTD PMID:21420995|PMID:22230336 TP53INP2 Human parathion decreases expression ISO RGD:1615099 6480464 Parathion results in decreased expression of TRP53INP2 mRNA CTD PMID:34813904 TP53INP2 Human perfluorononanoic acid decreases expression EXP 6480464 perfluoro-n-nonanoic acid results in decreased expression of TP53INP2 mRNA CTD PMID:32588087 TP53INP2 Human perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of TP53INP2 mRNA CTD PMID:32588087|PMID:36864359 TP53INP2 Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1615099 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TRP53INP2 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 TP53INP2 Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of TP53INP2 mRNA CTD PMID:32588087 TP53INP2 Human phenobarbital decreases expression ISO RGD:1615099 6480464 Phenobarbital results in decreased expression of TRP53INP2 mRNA CTD PMID:23091169 TP53INP2 Human pirinixic acid increases expression ISO RGD:1615099 6480464 pirinixic acid results in increased expression of TRP53INP2 mRNA CTD PMID:18301758 TP53INP2 Human pregnenolone 16alpha-carbonitrile increases expression ISO RGD:1615099 6480464 Pregnenolone Carbonitrile results in increased expression of TRP53INP2 mRNA CTD PMID:28903501 TP53INP2 Human resorcinol increases expression EXP 6480464 resorcinol results in increased expression of TP53INP2 mRNA CTD PMID:22623647 TP53INP2 Human rotenone decreases expression ISO RGD:735085 6480464 Rotenone results in decreased expression of TP53INP2 mRNA CTD PMID:28374803 TP53INP2 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TP53INP2 mRNA CTD PMID:35811015 TP53INP2 Human silicon dioxide affects expression EXP 6480464 Silicon Dioxide analog affects the expression of TP53INP2 mRNA CTD PMID:25895662 TP53INP2 Human sodium arsenite affects methylation EXP 6480464 sodium arsenite affects the methylation of TP53INP2 gene CTD PMID:28589171 TP53INP2 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of TP53INP2 mRNA CTD PMID:38568856 TP53INP2 Human sodium dichromate affects expression ISO RGD:735085 6480464 sodium bichromate affects the expression of TRP53INP2 mRNA CTD PMID:22110744 TP53INP2 Human sodium dichromate decreases expression ISO RGD:1615099 6480464 sodium bichromate results in decreased expression of TRP53INP2 mRNA CTD PMID:31558096 TP53INP2 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of TP53INP2 mRNA CTD PMID:31533062 TP53INP2 Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of TP53INP2 mRNA CTD PMID:31758290 TP53INP2 Human Tesaglitazar increases expression ISO RGD:735085 6480464 tesaglitazar results in increased expression of TRP53INP2 mRNA CTD PMID:21515302 TP53INP2 Human testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of TP53INP2 mRNA CTD PMID:21592394 TP53INP2 Human testosterone increases expression EXP 6480464 Testosterone results in increased expression of TP53INP2 mRNA CTD PMID:21592394 TP53INP2 Human tetrachloromethane affects expression ISO RGD:1615099 6480464 Carbon Tetrachloride affects the expression of TRP53INP2 mRNA CTD PMID:17484886 TP53INP2 Human tetrachloromethane multiple interactions ISO RGD:735085 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TP53INP2 mRNA] CTD PMID:31150632 TP53INP2 Human tetrachloromethane decreases expression ISO RGD:735085 6480464 Carbon Tetrachloride results in decreased expression of TP53INP2 mRNA CTD PMID:31150632 TP53INP2 Human thioacetamide decreases expression ISO RGD:735085 6480464 Thioacetamide results in decreased expression of TP53INP2 mRNA CTD PMID:23411599|PMID:34492290 TP53INP2 Human thiram increases expression EXP 6480464 Thiram results in increased expression of TP53INP2 mRNA CTD PMID:38568856 TP53INP2 Human titanium dioxide decreases methylation ISO RGD:1615099 6480464 titanium dioxide results in decreased methylation of TRP53INP2 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 TP53INP2 Human topotecan multiple interactions ISO RGD:735085 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TP53INP2 mRNA CTD PMID:25729387 TP53INP2 Human tributylstannane multiple interactions ISO RGD:735085 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of TP53INP2 mRNA CTD PMID:31129395 TP53INP2 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of TP53INP2 mRNA CTD PMID:37042841 TP53INP2 Human tunicamycin decreases expression ISO RGD:1615099 6480464 Tunicamycin results in decreased expression of TRP53INP2 mRNA CTD PMID:17127020 TP53INP2 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of TP53INP2 mRNA CTD PMID:29154799 TP53INP2 Human valproic acid affects expression ISO RGD:1615099 6480464 Valproic Acid affects the expression of TRP53INP2 mRNA CTD PMID:17292431 TP53INP2 Human valproic acid increases expression ISO RGD:1615099 6480464 Valproic Acid results in increased expression of TRP53INP2 mRNA CTD PMID:21427059 TP53INP2 Human zinc atom multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of TP53INP2 mRNA CTD PMID:18593933 TP53INP2 Human zinc(0) multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of TP53INP2 mRNA CTD PMID:18593933
(+)-schisandrin B (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (ISO) 2-palmitoylglycerol (EXP) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (ISO) actinomycin D (EXP) aflatoxin B1 (EXP,ISO) amitrole (ISO) ammonium chloride (ISO) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) benzene (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzo[b]fluoranthene (ISO) bisphenol A (ISO) bisphenol F (ISO) C60 fullerene (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) calcitriol (EXP) camptothecin (EXP) capsaicin (EXP) captan (ISO) carbon nanotube (ISO) chlordecone (ISO) clofibrate (ISO) cobalt dichloride (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) coumestrol (EXP) crocidolite asbestos (ISO) Cuprizon (ISO) cyclosporin A (EXP) DDE (EXP) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dicrotophos (EXP) diethylstilbestrol (ISO) dioxygen (ISO) diuron (ISO) Doramectin (ISO) endosulfan (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (EXP) fenthion (ISO) flutamide (ISO) folic acid (ISO) folpet (ISO) formaldehyde (EXP) genistein (EXP,ISO) gentamycin (ISO) inulin (ISO) lipopolysaccharide (EXP) methapyrilene (ISO) methidathion (ISO) methimazole (ISO) methyl methanesulfonate (EXP) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) nefazodone (ISO) nickel atom (EXP) Nutlin-3 (EXP) okadaic acid (EXP) oxaliplatin (ISO) ozone (EXP) Pachymic acid (EXP) paracetamol (EXP,ISO) parathion (ISO) perfluorononanoic acid (EXP) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) resorcinol (EXP) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (EXP) silicon dioxide (EXP) sodium arsenite (EXP) sodium dichromate (ISO) sunitinib (EXP) temozolomide (EXP) Tesaglitazar (ISO) testosterone (EXP) tetrachloromethane (ISO) thioacetamide (ISO) thiram (EXP) titanium dioxide (ISO) topotecan (ISO) tributylstannane (ISO) triphenyl phosphate (EXP) tunicamycin (ISO) valproic acid (EXP,ISO) zinc atom (EXP) zinc(0) (EXP)
TP53INP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 34,704,344 - 34,713,436 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 34,704,339 - 34,713,439 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 33,292,148 - 33,301,240 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 32,755,809 - 32,764,898 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 32,755,808 - 32,764,898 NCBI Celera 20 30,041,236 - 30,050,322 (+) NCBI Celera Cytogenetic Map 20 q11.22 NCBI HuRef 20 30,071,142 - 30,080,228 (+) NCBI HuRef CHM1_1 20 33,193,630 - 33,202,719 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 36,425,010 - 36,434,099 (+) NCBI T2T-CHM13v2.0
Trp53inp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 155,223,742 - 155,231,767 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 155,222,979 - 155,231,770 (+) Ensembl GRCm39 Ensembl GRCm38 2 155,381,811 - 155,389,847 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 155,381,059 - 155,389,850 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 155,207,592 - 155,215,583 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 155,073,297 - 155,081,288 (+) NCBI MGSCv36 mm8 Celera 2 161,314,382 - 161,322,371 (+) NCBI Celera Cytogenetic Map 2 H1 NCBI cM Map 2 77.26 NCBI
Tp53inp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 164,341,618 - 164,350,270 (+) NCBI GRCr8 mRatBN7.2 3 143,881,427 - 143,890,104 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 143,882,021 - 143,890,097 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 147,748,945 - 147,756,921 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 156,366,216 - 156,374,192 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 154,105,748 - 154,113,724 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 150,910,398 - 150,918,525 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 150,910,398 - 150,918,525 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 157,278,515 - 157,286,642 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 145,878,005 - 145,886,088 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 145,783,626 - 145,788,521 (+) NCBI Celera 3 142,607,828 - 142,615,961 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
Tp53inp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 26,640,239 - 26,649,291 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 26,640,239 - 26,649,291 (-) NCBI ChiLan1.0 ChiLan1.0
TP53INP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 40,438,314 - 40,447,459 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 40,431,438 - 40,440,564 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 31,033,855 - 31,042,976 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 32,160,155 - 32,169,227 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 32,160,155 - 32,169,227 (+) Ensembl panpan1.1 panPan2
TP53INP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 23,768,208 - 23,801,268 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 23,792,687 - 23,799,331 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 23,413,778 - 23,446,850 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 24,458,763 - 24,492,030 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 24,487,400 - 24,488,930 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 23,746,851 - 23,779,874 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 23,841,988 - 23,875,011 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 24,280,850 - 24,313,887 (+) NCBI UU_Cfam_GSD_1.0
Tp53inp2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 172,756,985 - 172,765,507 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936561 5,984,079 - 5,992,536 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936561 5,984,044 - 5,992,536 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TP53INP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 38,104,200 - 38,113,166 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 38,104,189 - 38,113,167 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 43,299,873 - 43,308,842 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TP53INP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 39,002,619 - 39,011,751 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 39,007,023 - 39,008,613 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 87,821,995 - 87,831,175 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tp53inp2
.
Predicted Target Of
Count of predictions: 4586 Count of miRNA genes: 1105 Interacting mature miRNAs: 1409 Transcripts: ENST00000374809, ENST00000374810, ENST00000414082, ENST00000451665 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597600838 GWAS1657698_H body mass index QTL GWAS1657698 (human) 2e-11 body mass index body mass index (BMI) (CMO:0000105) 20 34705089 34705090 Human 597189649 GWAS1285723_H testosterone measurement QTL GWAS1285723 (human) 2e-09 testosterone measurement serum testosterone level (CMO:0000568) 20 34709184 34709185 Human 597601137 GWAS1657997_H body mass index QTL GWAS1657997 (human) 1e-11 body mass index body mass index (BMI) (CMO:0000105) 20 34705089 34705090 Human
RH28655
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 33,301,002 - 33,301,086 UniSTS GRCh37 Build 36 20 32,764,663 - 32,764,747 RGD NCBI36 Celera 20 30,050,087 - 30,050,171 RGD Cytogenetic Map 20 q11.22 UniSTS HuRef 20 30,079,993 - 30,080,077 UniSTS
D20S714E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 33,301,113 - 33,301,185 UniSTS GRCh37 Build 36 20 32,764,774 - 32,764,846 RGD NCBI36 Celera 20 30,050,198 - 30,050,270 RGD Cytogenetic Map 20 q11.22 UniSTS HuRef 20 30,080,104 - 30,080,176 UniSTS
WI-8949
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 33,301,005 - 33,301,119 UniSTS GRCh37 Build 36 20 32,764,666 - 32,764,780 RGD NCBI36 Celera 20 30,050,090 - 30,050,204 RGD Cytogenetic Map 20 q11.22 UniSTS HuRef 20 30,079,996 - 30,080,110 UniSTS GeneMap99-GB4 RH Map 20 197.2 UniSTS GeneMap99-GB4 RH Map 20 203.62 UniSTS Whitehead-RH Map 20 211.5 UniSTS NCBI RH Map 20 299.3 UniSTS
G20521
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 33,300,953 - 33,301,168 UniSTS GRCh37 Build 36 20 32,764,614 - 32,764,829 RGD NCBI36 Celera 20 30,050,038 - 30,050,253 RGD Cytogenetic Map 20 q11.22 UniSTS HuRef 20 30,079,944 - 30,080,159 UniSTS
A005U42
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 33,300,953 - 33,301,168 UniSTS GRCh37 Build 36 20 32,764,614 - 32,764,829 RGD NCBI36 Celera 20 30,050,038 - 30,050,253 RGD Cytogenetic Map 20 q11.22 UniSTS HuRef 20 30,079,944 - 30,080,159 UniSTS GeneMap99-GB4 RH Map 20 200.16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1950
465
2270
7305
6471
53
3734
1
852
1744
1617
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000374809 ⟹ ENSP00000363942
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 34,704,339 - 34,713,439 (+) Ensembl
Ensembl Acc Id:
ENST00000374810 ⟹ ENSP00000363943
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 34,704,344 - 34,713,436 (+) Ensembl
Ensembl Acc Id:
ENST00000414082 ⟹ ENSP00000404410
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 34,704,735 - 34,709,343 (+) Ensembl
Ensembl Acc Id:
ENST00000451665 ⟹ ENSP00000395784
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 34,704,350 - 34,709,496 (+) Ensembl
RefSeq Acc Id:
NM_001329429 ⟹ NP_001316358
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 34,704,344 - 34,713,436 (+) NCBI T2T-CHM13v2.0 20 36,425,010 - 36,434,099 (+) NCBI
Sequence:
GCACAGACTCAAAGCCCCGCGGGCGAGCTCAGCAGCCCGGAGCGACCGCGGCCCCGCCGCCTCCCCCGCGAGTCCCGGCGATGCGGCCCGGCCTGTGAGCGGCCGGCGACCCTGGGACGCCCCGCCGC
hide sequence
RefSeq Acc Id:
NM_001329430 ⟹ NP_001316359
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 34,704,344 - 34,713,436 (+) NCBI T2T-CHM13v2.0 20 36,425,010 - 36,434,099 (+) NCBI
Sequence:
GCACAGACTCAAAGCCCCGCGGGCGAGCTCAGCAGCCCGGAGCGACCGCGGCCCCGCCGCCTCC
hide sequence
RefSeq Acc Id:
NM_001329431 ⟹ NP_001316360
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 34,704,719 - 34,713,436 (+) NCBI T2T-CHM13v2.0 20 36,425,385 - 36,434,099 (+) NCBI
Sequence:
AGGCTCGGGTCGCTTGTCCTCCCGTGACCCGGTAGCCGCTGTGTCGGGGCTGGGCCCTGGGGAATCTCTGGAGATTGGTTCACCTTTTGTGGTCCTGACCCCTTCTGTCCTCACTGTACCTTGAAGTC
hide sequence
RefSeq Acc Id:
NM_021202 ⟹ NP_067025
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 34,704,344 - 34,713,436 (+) NCBI GRCh37 20 33,292,147 - 33,301,240 (+) NCBI Build 36 20 32,755,809 - 32,764,898 (+) NCBI Archive Celera 20 30,041,236 - 30,050,322 (+) RGD HuRef 20 30,071,142 - 30,080,228 (+) ENTREZGENE CHM1_1 20 33,193,630 - 33,202,719 (+) NCBI T2T-CHM13v2.0 20 36,425,010 - 36,434,099 (+) NCBI
Sequence:
GCACAGACTCAAAGCCCCGCGGGCGAGCTCAGCAGCCCGGAGCGACCGCGGCCCCGCCGCCTCC
hide sequence
RefSeq Acc Id:
NP_067025 ⟸ NM_021202
- UniProtKB:
Q8IYL5 (UniProtKB/Swiss-Prot), Q5JX64 (UniProtKB/Swiss-Prot), E1P5P6 (UniProtKB/Swiss-Prot), A8K8S8 (UniProtKB/Swiss-Prot), Q9NU00 (UniProtKB/Swiss-Prot), Q8IXH6 (UniProtKB/Swiss-Prot)
- Sequence:
MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDESWFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPGSPSPLPDA
hide sequence
RefSeq Acc Id:
NP_001316358 ⟸ NM_001329429
- UniProtKB:
Q8IYL5 (UniProtKB/Swiss-Prot), Q5JX64 (UniProtKB/Swiss-Prot), E1P5P6 (UniProtKB/Swiss-Prot), A8K8S8 (UniProtKB/Swiss-Prot), Q9NU00 (UniProtKB/Swiss-Prot), Q8IXH6 (UniProtKB/Swiss-Prot)
- Sequence:
MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDESWFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPGSPSPLPDA
hide sequence
RefSeq Acc Id:
NP_001316359 ⟸ NM_001329430
- UniProtKB:
Q8IYL5 (UniProtKB/Swiss-Prot), Q5JX64 (UniProtKB/Swiss-Prot), E1P5P6 (UniProtKB/Swiss-Prot), A8K8S8 (UniProtKB/Swiss-Prot), Q9NU00 (UniProtKB/Swiss-Prot), Q8IXH6 (UniProtKB/Swiss-Prot)
- Sequence:
MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDESWFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPGSPSPLPDA
hide sequence
RefSeq Acc Id:
NP_001316360 ⟸ NM_001329431
- UniProtKB:
Q8IYL5 (UniProtKB/Swiss-Prot), Q5JX64 (UniProtKB/Swiss-Prot), E1P5P6 (UniProtKB/Swiss-Prot), A8K8S8 (UniProtKB/Swiss-Prot), Q9NU00 (UniProtKB/Swiss-Prot), Q8IXH6 (UniProtKB/Swiss-Prot)
- Sequence:
MFQRLSSLFFSTPSPPEDPDCPRAFVSEEDEVDGWLIIDLPDSYAAPPSPGAAPAPAGRPPPAPSLMDESWFVTPPACFTAEGPGLGPARLQSSPLEDLLIEHPSMSVYVTGSTIVLEPGSPSPLPDA
hide sequence
Ensembl Acc Id:
ENSP00000395784 ⟸ ENST00000451665
Ensembl Acc Id:
ENSP00000363942 ⟸ ENST00000374809
Ensembl Acc Id:
ENSP00000363943 ⟸ ENST00000374810
Ensembl Acc Id:
ENSP00000404410 ⟸ ENST00000414082
RGD ID: 6799141 Promoter ID: HG_KWN:39144 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: ENST00000374809, OTTHUMT00000078807, OTTHUMT00000078808, OTTHUMT00000078810 Position: Human Assembly Chr Position (strand) Source Build 36 20 32,755,641 - 32,756,232 (+) MPROMDB
RGD ID: 6812097 Promoter ID: HG_ACW:49017 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Lymphoblastoid, NB4 Transcripts: TP53INP2.BAPR07 Position: Human Assembly Chr Position (strand) Source Build 36 20 32,760,746 - 32,761,642 (+) MPROMDB
RGD ID: 13206739 Promoter ID: EPDNEW_H26950 Type: initiation region Name: TP53INP2_1 Description: tumor protein p53 inducible nuclear protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 20 34,704,344 - 34,704,404 EPDNEW
