Symbol:
TNFSF9
Name:
TNF superfamily member 9
RGD ID:
1343892
HGNC Page
HGNC:11939
Description:
Predicted to enable tumor necrosis factor receptor superfamily binding activity. Predicted to be involved in positive regulation of activated T cell proliferation and positive regulation of cytotoxic T cell differentiation. Predicted to act upstream of or within regulation of immature T cell proliferation in thymus. Predicted to be located in extracellular space and membrane. Predicted to be active in plasma membrane. Biomarker of acute myeloid leukemia; colorectal cancer; and multiple sclerosis.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
4-1BB ligand; 4-1BB-L; 4-1BBL; CD137 ligand; CD137L; homolog of mouse 4-1BB-L; receptor 4-1BB ligand; TNLG5A; tumor necrosis factor (ligand) superfamily member 9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand 5A; tumor necrosis factor ligand superfamily member 9; tumor necrosis factor superfamily member 9
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Tnfsf9 (tumor necrosis factor (ligand) superfamily, member 9)
HGNC
EggNOG, Ensembl, HGNC, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tnfsf9 (TNF superfamily member 9)
RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Tnfsf9 (TNF superfamily member 9)
NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
TNFSF9 (TNF superfamily member 9)
NCBI
Ortholog
Canis lupus familiaris (dog):
TNFSF9 (TNF superfamily member 9)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tnfsf9 (TNF superfamily member 9)
NCBI
Ortholog
Sus scrofa (pig):
TNFSF9 (TNF superfamily member 9)
HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
TNFSF9 (TNF superfamily member 9)
NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Tnfsf9 (TNF superfamily member 9)
NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tnfsf9 (TNF superfamily member 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tnfsf9 (tumor necrosis factor (ligand) superfamily, member 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 6,531,026 - 6,535,924 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 6,531,026 - 6,535,924 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 6,531,037 - 6,535,935 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 6,482,037 - 6,486,933 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 6,482,036 - 6,486,933 NCBI Celera 19 6,470,827 - 6,475,769 (+) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 6,293,216 - 6,297,937 (+) NCBI HuRef CHM1_1 19 6,530,958 - 6,535,882 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 6,520,520 - 6,525,499 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
TNFSF9 Human (-)-anisomycin increases expression EXP 6480464 Anisomycin results in increased expression of TNFSF9 mRNA CTD PMID:18241849 TNFSF9 Human (-)-anisomycin decreases expression EXP 6480464 Anisomycin results in decreased expression of TNFSF9 mRNA CTD PMID:24247028 TNFSF9 Human (S)-colchicine decreases expression EXP 6480464 Colchicine results in decreased expression of TNFSF9 mRNA CTD PMID:24211769 TNFSF9 Human 17beta-estradiol multiple interactions ISO Tnfsf9 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFSF9 mRNA CTD PMID:32741896 TNFSF9 Human 17beta-estradiol 3-benzoate multiple interactions ISO Tnfsf9 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFSF9 mRNA CTD PMID:32741896 TNFSF9 Human 1H-pyrazole multiple interactions ISO Tnfsf9 (Rattus norvegicus) 6480464 [Ethanol co-treated with pyrazole co-treated with Carbon Tetrachloride] results in increased expression of TNFSF9 mRNA CTD PMID:16610055 TNFSF9 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TNFSF9 mRNA CTD PMID:14761676 TNFSF9 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNFSF9 mRNA CTD PMID:33387578 TNFSF9 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tnfsf9 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TNFSF9 mRNA CTD PMID:15310856 and PMID:20819909 TNFSF9 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tnfsf9 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to TNFSF9 gene] CTD PMID:20819909 TNFSF9 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNFSF9 mRNA CTD PMID:11007951 TNFSF9 Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Tnfsf9 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 TNFSF9 Human 5-aza-2'-deoxycytidine increases expression EXP 6480464 Decitabine results in increased expression of TNFSF9 mRNA CTD PMID:16367923 TNFSF9 Human 6-propyl-2-thiouracil decreases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of TNFSF9 mRNA CTD PMID:24780913 TNFSF9 Human 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:21527772 TNFSF9 Human acrylamide increases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Acrylamide results in increased expression of TNFSF9 mRNA CTD PMID:28959563 TNFSF9 Human acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of TNFSF9 mRNA CTD PMID:32763439 TNFSF9 Human actinomycin D increases expression EXP 6480464 Dactinomycin results in increased expression of TNFSF9 mRNA CTD PMID:21527772 TNFSF9 Human adefovir pivoxil increases expression EXP 6480464 adefovir dipivoxil results in increased expression of TNFSF9 mRNA CTD PMID:25596134 TNFSF9 Human adenine decreases expression EXP 6480464 Adenine results in decreased expression of TNFSF9 mRNA CTD PMID:24211769 TNFSF9 Human aflatoxin B1 affects expression EXP 6480464 Aflatoxin B1 affects the expression of TNFSF9 protein CTD PMID:20106945 TNFSF9 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of TNFSF9 gene CTD PMID:27153756 TNFSF9 Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of TNFSF9 mRNA CTD PMID:21527772 more ... TNFSF9 Human all-trans-retinoic acid decreases expression ISO Tnfsf9 (Mus musculus) 6480464 Tretinoin results in decreased expression of TNFSF9 mRNA CTD PMID:16604517 TNFSF9 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of TNFSF9 mRNA CTD PMID:33167477 TNFSF9 Human amphetamine increases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Amphetamine results in increased expression of TNFSF9 mRNA CTD PMID:30779732 TNFSF9 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of TNFSF9 mRNA CTD PMID:33212167 TNFSF9 Human arsane decreases expression EXP 6480464 Arsenic results in decreased expression of TNFSF9 mRNA CTD PMID:19962721 TNFSF9 Human arsane multiple interactions EXP 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of TNFSF9 mRNA CTD PMID:19962721 TNFSF9 Human arsenic atom multiple interactions EXP 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of TNFSF9 mRNA CTD PMID:19962721 TNFSF9 Human arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of TNFSF9 mRNA CTD PMID:19962721 TNFSF9 Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of TNFSF9 mRNA CTD PMID:17530438 TNFSF9 Human avobenzone increases expression EXP 6480464 avobenzone results in increased expression of TNFSF9 mRNA CTD PMID:31016361 TNFSF9 Human Azoxymethane multiple interactions ISO Tnfsf9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TNFSF9 mRNA CTD PMID:29950665 TNFSF9 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TNFSF9 mRNA CTD PMID:20064835 more ... TNFSF9 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of TNFSF9 promoter CTD PMID:27901495 TNFSF9 Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7 more ... CTD PMID:19150397 TNFSF9 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of TNFSF9 mRNA CTD PMID:38218311 TNFSF9 Human bisphenol A increases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of TNFSF9 mRNA CTD PMID:25181051 TNFSF9 Human butanal increases expression EXP 6480464 butyraldehyde results in increased expression of TNFSF9 mRNA CTD PMID:26079696 TNFSF9 Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TNFSF9 mRNA CTD PMID:31738976 TNFSF9 Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of TNFSF9 mRNA and Cadmium Chloride results in increased expression of TNFSF9 protein CTD PMID:25596134 more ... TNFSF9 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TNFSF9 mRNA CTD PMID:31738976 TNFSF9 Human calciol increases expression ISO Tnfsf9 (Mus musculus) 6480464 Cholecalciferol results in increased expression of TNFSF9 mRNA CTD PMID:17170073 TNFSF9 Human camptothecin increases expression EXP 6480464 Camptothecin results in increased expression of TNFSF9 mRNA CTD PMID:17374387 TNFSF9 Human carbon nanotube increases expression ISO Tnfsf9 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 TNFSF9 Human chloroacetaldehyde increases expression EXP 6480464 chloroacetaldehyde results in increased expression of TNFSF9 mRNA CTD PMID:25596134 TNFSF9 Human chloroprene decreases expression ISO Tnfsf9 (Mus musculus) 6480464 Chloroprene results in decreased expression of TNFSF9 mRNA CTD PMID:23125180 TNFSF9 Human chromium(6+) multiple interactions EXP 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of TNFSF9 mRNA CTD PMID:38479592 TNFSF9 Human cidofovir anhydrous increases expression EXP 6480464 Cidofovir results in increased expression of TNFSF9 mRNA CTD PMID:25596134 TNFSF9 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of TNFSF9 mRNA CTD PMID:24211769 TNFSF9 Human cisplatin multiple interactions EXP 6480464 Cisplatin promotes the reaction [jinfukang results in increased expression of TNFSF9 mRNA] and jinfukang promotes the reaction [Cisplatin results in increased expression of TNFSF9 mRNA] CTD PMID:27392435 TNFSF9 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of TNFSF9 mRNA CTD PMID:19561079 more ... TNFSF9 Human cobalt atom increases expression ISO Tnfsf9 (Mus musculus) 6480464 Cobalt results in increased expression of TNFSF9 mRNA CTD PMID:34468815 TNFSF9 Human cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of TNFSF9 mRNA CTD PMID:19376846 TNFSF9 Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of TNFSF9 mRNA CTD PMID:20971185 TNFSF9 Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of TNFSF9 mRNA CTD PMID:20971185 TNFSF9 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of TNFSF9 mRNA CTD PMID:19549813 TNFSF9 Human cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of TNFSF9 mRNA CTD PMID:21527772 TNFSF9 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of TNFSF9 mRNA CTD PMID:20106945 more ... TNFSF9 Human daunorubicin increases expression EXP 6480464 Daunorubicin results in increased expression of TNFSF9 mRNA CTD PMID:17374387 TNFSF9 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of TNFSF9 mRNA CTD PMID:38568856 TNFSF9 Human deoxynivalenol decreases expression EXP 6480464 deoxynivalenol results in decreased expression of TNFSF9 mRNA CTD PMID:24247028 TNFSF9 Human dexamethasone increases expression ISO Tnfsf9 (Mus musculus) 6480464 Dexamethasone results in increased expression of TNFSF9 mRNA CTD PMID:17998272 TNFSF9 Human dextran sulfate multiple interactions ISO Tnfsf9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TNFSF9 mRNA CTD PMID:29950665 TNFSF9 Human diallyl trisulfide decreases expression EXP 6480464 diallyl trisulfide results in decreased expression of TNFSF9 mRNA CTD PMID:34995734 TNFSF9 Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of TNFSF9 mRNA CTD PMID:17530438 TNFSF9 Human dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of TNFSF9 mRNA CTD PMID:31068361 TNFSF9 Human diethylstilbestrol increases expression ISO Tnfsf9 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of TNFSF9 mRNA CTD PMID:16510352 TNFSF9 Human dioxygen increases expression ISO Tnfsf9 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of TNFSF9 mRNA CTD PMID:20880076 TNFSF9 Human dioxygen multiple interactions ISO Tnfsf9 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TNFSF9 mRNA CTD PMID:30529165 TNFSF9 Human dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of TNFSF9 mRNA CTD PMID:26516004 TNFSF9 Human dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of TNFSF9 mRNA CTD PMID:25596134 TNFSF9 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 TNFSF9 Human endosulfan increases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Endosulfan results in increased expression of TNFSF9 mRNA CTD PMID:29391264 TNFSF9 Human endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of TNFSF9 mRNA CTD PMID:30090376 TNFSF9 Human entinostat multiple interactions EXP 6480464 [Ionomycin co-treated with Phorbol Esters] promotes the reaction [entinostat results in increased expression of TNFSF9 mRNA] more ... CTD PMID:19759901 and PMID:27188386 TNFSF9 Human entinostat increases expression EXP 6480464 entinostat results in increased expression of TNFSF9 mRNA CTD PMID:19759901 more ... TNFSF9 Human ethanol multiple interactions ISO Tnfsf9 (Rattus norvegicus) 6480464 [Ethanol co-treated with pyrazole co-treated with Carbon Tetrachloride] results in increased expression of TNFSF9 mRNA CTD PMID:16610055 TNFSF9 Human ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of TNFSF9 mRNA CTD PMID:28986285 TNFSF9 Human etoposide increases expression EXP 6480464 Etoposide results in increased expression of TNFSF9 mRNA CTD PMID:17374387 TNFSF9 Human formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of TNFSF9 mRNA CTD PMID:20655997 and PMID:23649840 TNFSF9 Human furosemide affects expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Furosemide affects the expression of TNFSF9 mRNA CTD PMID:17497460 TNFSF9 Human genistein increases expression EXP 6480464 Genistein results in increased expression of TNFSF9 mRNA CTD PMID:18847459 TNFSF9 Human gentamycin decreases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of TNFSF9 mRNA CTD PMID:33387578 TNFSF9 Human ifosfamide increases expression EXP 6480464 Ifosfamide results in increased expression of TNFSF9 mRNA CTD PMID:25596134 TNFSF9 Human ionomycin multiple interactions EXP 6480464 [Ionomycin co-treated with Phorbol Esters] promotes the reaction [entinostat results in increased expression of TNFSF9 mRNA] more ... CTD PMID:19759901 TNFSF9 Human iron dichloride increases expression EXP 6480464 ferrous chloride results in increased expression of TNFSF9 mRNA CTD PMID:35984750 TNFSF9 Human isoflurane decreases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Isoflurane results in decreased expression of TNFSF9 mRNA CTD PMID:16978161 TNFSF9 Human lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of TNFSF9 mRNA CTD PMID:38568856 TNFSF9 Human lead(0) affects expression EXP 6480464 Lead affects the expression of TNFSF9 mRNA CTD PMID:28903495 TNFSF9 Human Licochalcone B increases expression EXP 6480464 licochalcone B results in increased expression of TNFSF9 mRNA CTD PMID:33647349 TNFSF9 Human lipopolysaccharide increases expression ISO Tnfsf9 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of TNFSF9 mRNA CTD PMID:26582142 TNFSF9 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1 more ... CTD PMID:35811015 TNFSF9 Human lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of TNFSF9 mRNA CTD PMID:35811015 TNFSF9 Human MeIQx increases expression EXP 6480464 2-amino-3 more ... CTD PMID:20816883 TNFSF9 Human mercury dibromide increases expression EXP 6480464 mercuric bromide results in increased expression of TNFSF9 mRNA CTD PMID:26272509 TNFSF9 Human mercury dibromide multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFSF9 mRNA CTD PMID:27188386 TNFSF9 Human methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of TNFSF9 mRNA CTD PMID:17400583 TNFSF9 Human methyl methanesulfonate increases expression EXP 6480464 Methyl Methanesulfonate results in increased expression of TNFSF9 mRNA CTD PMID:21527772 TNFSF9 Human methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of TNFSF9 mRNA CTD PMID:28001369 TNFSF9 Human nickel sulfate increases expression ISO Tnfsf9 (Mus musculus) 6480464 nickel sulfate results in increased expression of TNFSF9 mRNA CTD PMID:16166746 TNFSF9 Human Nutlin-3 increases expression EXP 6480464 nutlin 3 results in increased expression of TNFSF9 mRNA CTD PMID:38460933 TNFSF9 Human ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of TNFSF9 mRNA CTD PMID:30559759 TNFSF9 Human ozone multiple interactions ISO Tnfsf9 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of TNFSF9 mRNA more ... CTD PMID:19555225 more ... TNFSF9 Human p-chloromercuribenzoic acid increases expression EXP 6480464 p-Chloromercuribenzoic Acid results in increased expression of TNFSF9 mRNA CTD PMID:26272509 TNFSF9 Human p-chloromercuribenzoic acid multiple interactions EXP 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFSF9 mRNA CTD PMID:27188386 TNFSF9 Human p-menthan-3-ol increases expression EXP 6480464 Menthol results in increased expression of TNFSF9 mRNA CTD PMID:26760959 TNFSF9 Human panobinostat multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFSF9 mRNA CTD PMID:27188386 TNFSF9 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TNFSF9 mRNA CTD PMID:29067470 TNFSF9 Human paraquat increases expression ISO Tnfsf9 (Mus musculus) 6480464 Paraquat results in increased expression of TNFSF9 mRNA CTD PMID:22938100 TNFSF9 Human paraquat increases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Paraquat results in increased expression of TNFSF9 mRNA CTD PMID:32680482 TNFSF9 Human pentanal increases expression EXP 6480464 pentanal results in increased expression of TNFSF9 mRNA CTD PMID:26079696 TNFSF9 Human perfluorohexanesulfonic acid increases expression ISO Tnfsf9 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of TNFSF9 mRNA CTD PMID:37995155 TNFSF9 Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of TNFSF9 mRNA CTD PMID:26272509 TNFSF9 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFSF9 mRNA CTD PMID:27188386 TNFSF9 Human pinostrobin increases expression EXP 6480464 pinostrobin results in increased expression of TNFSF9 mRNA CTD PMID:37777166 TNFSF9 Human poly(I:C) multiple interactions EXP 6480464 [TL8-506 co-treated with Poly I-C] results in increased expression of TNFSF9 mRNA CTD PMID:35688559 TNFSF9 Human potassium bromate increases expression EXP 6480464 potassium bromate results in increased expression of TNFSF9 mRNA CTD PMID:30559759 TNFSF9 Human propanal increases expression EXP 6480464 propionaldehyde results in increased expression of TNFSF9 mRNA CTD PMID:26079696 TNFSF9 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1 more ... CTD PMID:35811015 TNFSF9 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 TNFSF9 Human silicon dioxide increases expression ISO Tnfsf9 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of TNFSF9 mRNA CTD PMID:19073995 TNFSF9 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of TNFSF9 mRNA CTD PMID:25351596 TNFSF9 Human silver atom increases expression EXP 6480464 Silver results in increased expression of TNFSF9 mRNA CTD PMID:26014281 TNFSF9 Human silver(0) increases expression EXP 6480464 Silver results in increased expression of TNFSF9 mRNA CTD PMID:26014281 TNFSF9 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of TNFSF9 mRNA CTD PMID:29301061 more ... TNFSF9 Human sodium arsenite decreases expression ISO Tnfsf9 (Mus musculus) 6480464 sodium arsenite results in decreased expression of TNFSF9 mRNA CTD PMID:37682722 TNFSF9 Human Soman increases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 Soman results in increased expression of TNFSF9 mRNA CTD PMID:19281266 TNFSF9 Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of TNFSF9 mRNA CTD PMID:31758290 TNFSF9 Human testosterone multiple interactions ISO Tnfsf9 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFSF9 mRNA CTD PMID:32741896 TNFSF9 Human tetrachloromethane multiple interactions ISO Tnfsf9 (Rattus norvegicus) 6480464 [Ethanol co-treated with pyrazole co-treated with Carbon Tetrachloride] results in increased expression of TNFSF9 mRNA CTD PMID:16610055 TNFSF9 Human thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of TNFSF9 mRNA CTD PMID:24247028 TNFSF9 Human thiram increases expression EXP 6480464 Thiram results in increased expression of TNFSF9 mRNA CTD PMID:38568856 TNFSF9 Human titanium dioxide decreases expression ISO Tnfsf9 (Mus musculus) 6480464 titanium dioxide results in decreased expression of TNFSF9 mRNA CTD PMID:29264374 TNFSF9 Human titanium dioxide decreases methylation ISO Tnfsf9 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TNFSF9 gene CTD PMID:35295148 TNFSF9 Human titanium dioxide multiple interactions ISO Tnfsf9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TNFSF9 mRNA CTD PMID:29950665 TNFSF9 Human titanium dioxide increases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 titanium dioxide results in increased expression of TNFSF9 mRNA CTD PMID:30012374 TNFSF9 Human Tributyltin oxide increases expression EXP 6480464 bis(tri-n-butyltin)oxide results in increased expression of TNFSF9 mRNA CTD PMID:24247028 TNFSF9 Human trichostatin A multiple interactions EXP 6480464 [Ionomycin co-treated with Phorbol Esters] promotes the reaction [trichostatin A results in increased expression of TNFSF9 mRNA] and mithramycin A inhibits the reaction [trichostatin A results in increased expression of TNFSF9 mRNA] CTD PMID:19759901 TNFSF9 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of TNFSF9 mRNA CTD PMID:19759901 and PMID:24935251 TNFSF9 Human troglitazone decreases expression ISO Tnfsf9 (Rattus norvegicus) 6480464 troglitazone results in decreased expression of TNFSF9 mRNA CTD PMID:21515302 TNFSF9 Human urethane increases expression EXP 6480464 Urethane results in increased expression of TNFSF9 mRNA CTD PMID:28818685 TNFSF9 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of TNFSF9 mRNA CTD PMID:25979313 TNFSF9 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TNFSF9 mRNA CTD PMID:27188386 TNFSF9 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of TNFSF9 mRNA CTD PMID:23179753 more ... TNFSF9 Human vincristine increases expression EXP 6480464 Vincristine results in increased expression of TNFSF9 mRNA CTD PMID:23649840 TNFSF9 Human vorinostat multiple interactions EXP 6480464 [Ionomycin co-treated with Phorbol Esters] promotes the reaction [vorinostat results in increased expression of TNFSF9 mRNA] CTD PMID:19759901 TNFSF9 Human vorinostat increases expression EXP 6480464 vorinostat results in increased expression of TNFSF9 mRNA CTD PMID:19759901 and PMID:27188386 TNFSF9 Human XL147 multiple interactions ISO Tnfsf9 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in increased expression of TNFSF9 mRNA CTD PMID:27935865 TNFSF9 Human zinc atom multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of TNFSF9 mRNA CTD PMID:18593933 TNFSF9 Human zinc(0) multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of TNFSF9 mRNA CTD PMID:18593933 TNFSF9 Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of TNFSF9 mRNA CTD PMID:25596134
(-)-anisomycin (EXP) (S)-colchicine (EXP) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 5-aza-2'-deoxycytidine (EXP) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (EXP) acrylamide (EXP,ISO) actinomycin D (EXP) adefovir pivoxil (EXP) adenine (EXP) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP,ISO) amphetamine (ISO) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) arsenous acid (EXP) avobenzone (EXP) Azoxymethane (ISO) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (EXP) beta-lapachone (EXP) bisphenol A (ISO) butanal (EXP) cadmium atom (EXP) cadmium dichloride (EXP) calciol (ISO) camptothecin (EXP) carbon nanotube (ISO) chloroacetaldehyde (EXP) chloroprene (ISO) chromium(6+) (EXP) cidofovir anhydrous (EXP) cisplatin (EXP) cobalt atom (ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (EXP) cyclophosphamide (EXP) cyclosporin A (EXP) daunorubicin (EXP) DDE (EXP) deoxynivalenol (EXP) dexamethasone (ISO) dextran sulfate (ISO) diallyl trisulfide (EXP) diarsenic trioxide (EXP) dieldrin (EXP) diethylstilbestrol (ISO) dioxygen (EXP,ISO) dorsomorphin (EXP) endosulfan (EXP,ISO) entinostat (EXP) ethanol (EXP,ISO) etoposide (EXP) formaldehyde (EXP) furosemide (ISO) genistein (EXP) gentamycin (ISO) ifosfamide (EXP) ionomycin (EXP) iron dichloride (EXP) isoflurane (ISO) lead diacetate (EXP) lead(0) (EXP) Licochalcone B (EXP) lipopolysaccharide (EXP,ISO) MeIQx (EXP) mercury dibromide (EXP) methotrexate (EXP) methyl methanesulfonate (EXP) methylmercury chloride (EXP) nickel sulfate (ISO) Nutlin-3 (EXP) ochratoxin A (EXP) ozone (ISO) p-chloromercuribenzoic acid (EXP) p-menthan-3-ol (EXP) panobinostat (EXP) paracetamol (EXP) paraquat (ISO) pentanal (EXP) perfluorohexanesulfonic acid (ISO) phenylmercury acetate (EXP) pinostrobin (EXP) poly(I:C) (EXP) potassium bromate (EXP) propanal (EXP) S-(1,2-dichlorovinyl)-L-cysteine (EXP) SB 431542 (EXP) silicon dioxide (EXP,ISO) silver atom (EXP) silver(0) (EXP) sodium arsenite (EXP,ISO) Soman (ISO) temozolomide (EXP) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (EXP) thiram (EXP) titanium dioxide (ISO) Tributyltin oxide (EXP) trichostatin A (EXP) troglitazone (ISO) urethane (EXP) valproic acid (EXP) vincristine (EXP) vorinostat (EXP) XL147 (ISO) zinc atom (EXP) zinc(0) (EXP) zoledronic acid (EXP)
1.
Expression of CD137 and CD137 ligand in colorectal cancer patients.
Dimberg J, etal., Oncol Rep. 2006 May;15(5):1197-200.
2.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
3.
4-1BBL cooperates with B7-1 and B7-2 in converting a B cell lymphoma cell line into a long-lasting antitumor vaccine.
Guinn BA, etal., J Immunol. 1999 Apr 15;162(8):5003-10.
4.
Increased soluble 4-1BB ligand (4-1BBL) levels in peripheral blood of patients with multiple sclerosis.
Liu GZ, etal., Scand J Immunol. 2006 Oct;64(4):412-9.
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
Soluble CD137 (4-1BB) ligand is released following leukocyte activation and is found in sera of patients with hematological malignancies.
Salih HR, etal., J Immunol. 2001 Oct 1;167(7):4059-66.
7.
Soluble PD-1 facilitates 4-1BBL-triggered antitumor immunity against murine H22 hepatocarcinoma in vivo.
Xiao H, etal., Clin Cancer Res. 2007 Mar 15;13(6):1823-30. Epub 2007 Feb 26.
8.
Targeted and untargeted CD137L fusion proteins for the immunotherapy of experimental solid tumors.
Zhang N, etal., Clin Cancer Res. 2007 May 1;13(9):2758-67. Epub 2007 Apr 25.
TNFSF9 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 6,531,026 - 6,535,924 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 6,531,026 - 6,535,924 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 6,531,037 - 6,535,935 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 6,482,037 - 6,486,933 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 6,482,036 - 6,486,933 NCBI Celera 19 6,470,827 - 6,475,769 (+) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 6,293,216 - 6,297,937 (+) NCBI HuRef CHM1_1 19 6,530,958 - 6,535,882 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 6,520,520 - 6,525,499 (+) NCBI T2T-CHM13v2.0
Tnfsf9 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 57,412,113 - 57,414,757 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 57,412,325 - 57,414,757 (+) Ensembl GRCm39 Ensembl GRCm38 17 57,105,287 - 57,107,758 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 57,105,325 - 57,107,757 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 57,244,808 - 57,247,180 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 56,790,776 - 56,792,848 (+) NCBI MGSCv36 mm8 Celera 17 61,453,915 - 61,456,287 (+) NCBI Celera Cytogenetic Map 17 D NCBI cM Map 17 29.67 NCBI
Tnfsf9 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 2,031,011 - 2,033,345 (+) NCBI GRCr8 mRatBN7.2 9 1,944,017 - 1,946,351 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 1,944,017 - 1,946,345 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 2,378,289 - 2,380,620 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 60,384 - 62,715 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,683,512 - 6,685,843 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 9,909,942 - 9,912,276 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 9,909,948 - 9,912,276 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 8,913,004 - 8,915,338 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 6,571,461 - 6,573,795 (-) NCBI Celera Cytogenetic Map 9 q11 NCBI
Tnfsf9 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955495 3,101,965 - 3,107,552 (-) NCBI ChiLan1.0 ChiLan1.0
TNFSF9 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 10,938,504 - 10,943,394 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 10,164,430 - 10,169,327 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 5,558,021 - 5,562,901 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 6,476,941 - 6,483,352 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 6,476,941 - 6,483,352 (+) Ensembl panpan1.1 panPan2
TNFSF9 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 53,680,882 - 53,682,521 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 53,679,880 - 53,682,706 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 53,426,553 - 53,439,382 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 54,333,423 - 54,336,590 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 20 53,400,156 - 53,403,326 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 53,848,757 - 53,851,741 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 54,077,742 - 54,080,911 (-) NCBI UU_Cfam_GSD_1.0
Tnfsf9 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
TNFSF9 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 72,578,821 - 72,582,745 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 72,578,811 - 72,582,834 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 73,102,064 - 73,106,173 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TNFSF9 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 6,131,157 - 6,136,345 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 6,131,571 - 6,135,463 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 1,866,430 - 1,872,328 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tnfsf9 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 637 Count of miRNA genes: 365 Interacting mature miRNAs: 377 Transcripts: ENST00000245817 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1298499 UAE1_H Urinary albumin excretion QTL 1 (human) 2.73 0.0009 Urinary albumin excretion urine albumin:creatinine ratio (ACR) 19 1 16075902 Human 1643451 SLIPL6_H Serum lipid level QTL 6 (human) 2.19 0.0008 Lipid level 19 1 16075902 Human 1581534 BP76_H Blood pressure QTL 76 (human) 2 0.001 Blood pressure pulse pressure 19 1 16075902 Human 1581535 BP65_H Blood pressure QTL 65 (human) 3.1 0.001 Blood pressure pulse pressure 19 1 16075902 Human 2314591 INSUL4_H Insulin level QTL 4 (human) 3.8 0.000038 Insulin level fasting 19 1 16075902 Human 1298476 BP3_H Blood pressure QTL 3 (human) 2.4 Blood pressure systolic 19 1 16075902 Human
SHGC-35317
Human Assembly Chr Position (strand) Source JBrowse GRCh37 19 6,535,156 - 6,535,355 UniSTS GRCh37 Build 36 19 6,486,156 - 6,486,355 RGD NCBI36 Celera 19 6,474,987 - 6,475,186 RGD Cytogenetic Map 19 p13.3 UniSTS HuRef 19 6,297,157 - 6,297,356 UniSTS GeneMap99-GB4 RH Map 19 38.82 UniSTS Whitehead-RH Map 19 23.6 UniSTS GeneMap99-G3 RH Map 19 229.0 UniSTS
G15865
Human Assembly Chr Position (strand) Source JBrowse GRCh37 19 6,535,162 - 6,535,376 UniSTS GRCh37 Build 36 19 6,486,162 - 6,486,376 RGD NCBI36 Celera 19 6,474,993 - 6,475,207 RGD Cytogenetic Map 19 p13.3 UniSTS HuRef 19 6,297,163 - 6,297,377 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1203
2418
2770
2221
4945
1674
2291
6
599
1910
441
2267
7196
6393
52
3704
1
846
1720
1584
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000245817 ⟹ ENSP00000245817
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 19 6,531,026 - 6,535,924 (+) Ensembl
RefSeq Acc Id:
NM_003811 ⟹ NP_003802
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 19 6,531,026 - 6,535,924 (+) NCBI GRCh37 19 6,531,010 - 6,535,939 (+) ENTREZGENE Build 36 19 6,482,037 - 6,486,933 (+) NCBI Archive HuRef 19 6,293,216 - 6,297,937 (+) ENTREZGENE CHM1_1 19 6,530,958 - 6,535,882 (+) NCBI T2T-CHM13v2.0 19 6,520,520 - 6,525,499 (+) NCBI
Sequence:
AGTCTCTCGTCATGGAATACGCCTCTGACGCTTCACTGGACCCCGAAGCCCCGTGGCCTCCCGCGCCCCGCGCTCGCGCCTGCCGCGTACTGCCTTGGGCCCTGGTCGCGGGGCTGCTGCTGCTGCTG CTGCTCGCTGCCGCCTGCGCCGTCTTCCTCGCCTGCCCCTGGGCCGTGTCCGGGGCTCGCGCCTCGCCCGGCTCCGCGGCCAGCCCGAGACTCCGCGAGGGTCCCGAGCTTTCGCCCGACGATCCCGC CGGCCTCTTGGACCTGCGGCAGGGCATGTTTGCGCAGCTGGTGGCCCAAAATGTTCTGCTGATCGATGGGCCCCTGAGCTGGTACAGTGACCCAGGCCTGGCAGGCGTGTCCCTGACGGGGGGCCTGA GCTACAAAGAGGACACGAAGGAGCTGGTGGTGGCCAAGGCTGGAGTCTACTATGTCTTCTTTCAACTAGAGCTGCGGCGCGTGGTGGCCGGCGAGGGCTCAGGCTCCGTTTCACTTGCGCTGCACCTG CAGCCACTGCGCTCTGCTGCTGGGGCCGCCGCCCTGGCTTTGACCGTGGACCTGCCACCCGCCTCCTCCGAGGCTCGGAACTCGGCCTTCGGTTTCCAGGGCCGCTTGCTGCACCTGAGTGCCGGCCA GCGCCTGGGCGTCCATCTTCACACTGAGGCCAGGGCACGCCATGCCTGGCAGCTTACCCAGGGCGCCACAGTCTTGGGACTCTTCCGGGTGACCCCCGAAATCCCAGCCGGACTCCCTTCACCGAGGT CGGAATAACGTCCAGCCTGGGTGCAGCCCACCTGGACAGAGTCCGAATCCTACTCCATCCTTCATGGAGACCCCTGGTGCTGGGTCCCTGCTGCTTTCTCTACCTCAAGGGGCTTGGCAGGGGTCCCT GCTGCTGACCTCCCCTTGAGGACCCTCCTCACCCACTCCTTCCCCAAGTTGGACCTTGATATTTATTCTGAGCCTGAGCTCAGATAATATATTATATATATTATATATATATATATATTTCTATTTAA AGAGGATCCTGAGTTTGTGAATGGACTTTTTTAGAGGAGTTGTTTTGGGGGGGGGGGGGTCTTCGACATTGCCGAGGCTGGTCTTGAACTCCTGGACTTAGACGATCCTCCTGCCTCAGCCTCCCAAG CAACTGGGATTCATCCTTTCTATTAATTCATTGTACTTATTTGCTTATTTGTGTGTATTGAGCATCTGTAATGTGCCAGCATTGTGCCCAGGCTAGGGGGCTATAGAAACATCTAGAAATAGACTGAA AGAAAATCTGAGTTATGGTAATACGTGAGGAATTTAAAGACTCATCCCCAGCCTCCACCTCCTGTGTGATACTTGGGGGCTAGCTTTTTTCTTTCTTTCTTTTTTTTGAGATGGTCTTGTTCTGTCAA CCAGGCTAGAATGCAGCGGTGCAATCATGAGTCAATGCAGCCTCCAGCCTCGACCTCCCGAGGCTCAGGTGATCCTCCCATCTCAGCCTCTCGAGTAGCTGGGACCACAGTTGTGTGCCACCACACTT GGCTAACTTTTTAATTTTTTTGCGGAGACGGTATTGCTATGTTGCCAAGGTTGTTTACATGCCAGTACAATTTATAATAAACACTCATTTTTCCTCCC
hide sequence
RefSeq Acc Id:
NP_003802 ⟸ NM_003811
- UniProtKB:
Q2M3S2 (UniProtKB/Swiss-Prot), P41273 (UniProtKB/Swiss-Prot), A0A0U5J8I0 (UniProtKB/TrEMBL), B2RA14 (UniProtKB/TrEMBL)
- Sequence:
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKE DTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
hide sequence
Ensembl Acc Id:
ENSP00000245817 ⟸ ENST00000245817
RGD ID: 6796128
Promoter ID: HG_KWN:28663
Type: CpG-Island
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4
Transcripts: NM_003811
Position: Human Assembly Chr Position (strand) Source Build 36 19 6,481,851 - 6,482,351 (+) MPROMDB
RGD ID: 7238231
Promoter ID: EPDNEW_H24861
Type: multiple initiation site
Name: TNFSF9_1
Description: TNF superfamily member 9
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Human Assembly Chr Position (strand) Source GRCh38 19 6,531,026 - 6,531,086 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-07
TNFSF9
TNF superfamily member 9
TNFSF9
tumor necrosis factor superfamily member 9
Symbol and/or name change
5135510
APPROVED
2015-11-24
TNFSF9
tumor necrosis factor superfamily member 9
TNFSF9
tumor necrosis factor (ligand) superfamily, member 9
Symbol and/or name change
5135510
APPROVED