Advanced Search (OLGA)

Gene: DDIT4L (DNA damage inducible transcript 4 like) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

DDIT4L

Name:

DNA damage inducible transcript 4 like

RGD ID:

1342784

HGNC Page

HGNC:30555

Description:

Predicted to be involved in negative regulation of signal transduction. Predicted to be located in cytoplasm.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DNA damage-inducible transcript 4-like protein; DNA-damage-inducible transcript 4-like; HIF-1 responsive protein RTP801-like; homolog of mouse SMHS1; REDD-2; REDD2; regulated in development and DNA damage response 2; Rtp801L

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	100,185,870 - 100,190,468 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	100,185,870 - 100,190,782 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	101,107,027 - 101,111,625 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	101,326,050 - 101,330,636 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	101,464,206 - 101,468,791	NCBI
Celera	4	98,405,052 - 98,409,638 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI
HuRef	4	96,845,264 - 96,850,266 (-)	NCBI		HuRef
CHM1_1	4	101,083,602 - 101,088,230 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	103,501,503 - 103,506,101 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
DDIT4L	Human	melanoma		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16778180

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
DDIT4L	Human	1,2-dimethylhydrazine	increases expression	ISO	RGD:733457	6480464	1,2-Dimethylhydrazine results in increased expression of DDIT4L mRNA	CTD	PMID:22206623
DDIT4L	Human	17beta-estradiol	decreases expression	ISO	RGD:733457	6480464	Estradiol results in decreased expression of DDIT4L mRNA	CTD	PMID:19484750
DDIT4L	Human	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of DDIT4L mRNA	CTD	PMID:36828454
DDIT4L	Human	17beta-estradiol	decreases expression	ISO	RGD:2322961	6480464	Estradiol results in decreased expression of DDIT4L mRNA	CTD	PMID:32145629
DDIT4L	Human	1H-pyrazole	increases expression	ISO	RGD:733457	6480464	pyrazole results in increased expression of DDIT4L mRNA	CTD	PMID:17945193
DDIT4L	Human	2,2',5,5'-tetrachlorobiphenyl	increases expression	EXP		6480464	2,5,2',5'-tetrachlorobiphenyl analog results in increased expression of DDIT4L mRNA	CTD	PMID:36804509
DDIT4L	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:733457	6480464	Tetrachlorodibenzodioxin results in increased expression of DDIT4L mRNA	CTD	PMID:19933214
DDIT4L	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:2322961	6480464	Tetrachlorodibenzodioxin results in decreased expression of DDIT4L mRNA	CTD	PMID:34747641
DDIT4L	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:2322961	6480464	Tetrachlorodibenzodioxin results in increased expression of DDIT4L mRNA	CTD	PMID:20558275\|PMID:32109520
DDIT4L	Human	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:733457	6480464	[TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression more ...	CTD	PMID:25975270
DDIT4L	Human	2-acetamidofluorene	increases expression	ISO	RGD:733457	6480464	2-Acetylaminofluorene results in increased expression of DDIT4L mRNA	CTD	PMID:21607683
DDIT4L	Human	2-amino-2-deoxy-D-glucopyranose	increases expression	ISO	RGD:2322961	6480464	Glucosamine results in increased expression of DDIT4L mRNA	CTD	PMID:17109745
DDIT4L	Human	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:733457	6480464	bisphenol S results in decreased expression of DDIT4L mRNA	CTD	PMID:30951980
DDIT4L	Human	4-amino-2,6-dinitrotoluene	affects expression	ISO	RGD:2322961	6480464	4-amino-2,6-dinitrotoluene affects the expression of DDIT4L mRNA	CTD	PMID:21346803
DDIT4L	Human	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:733457	6480464	Fenretinide results in increased expression of DDIT4L mRNA	CTD	PMID:28973697
DDIT4L	Human	7,12-dimethyltetraphene	increases expression	ISO	RGD:733457	6480464	9,10-Dimethyl-1,2-benzanthracene metabolite results in increased expression of DDIT4L mRNA	CTD	PMID:32553695
DDIT4L	Human	acrylamide	decreases expression	ISO	RGD:733457	6480464	Acrylamide results in decreased expression of DDIT4L mRNA	CTD	PMID:30807115
DDIT4L	Human	aflatoxin B1	increases expression	ISO	RGD:733457	6480464	Aflatoxin B1 results in increased expression of DDIT4L mRNA	CTD	PMID:19770486
DDIT4L	Human	aflatoxin B1	increases expression	ISO	RGD:2322961	6480464	Aflatoxin B1 results in increased expression of DDIT4L mRNA	CTD	PMID:22545673\|PMID:23630614\|PMID:25378103
DDIT4L	Human	aflatoxin B1	increases methylation	EXP		6480464	Aflatoxin B1 results in increased methylation of DDIT4L gene	CTD	PMID:27153756
DDIT4L	Human	aldehydo-D-glucosamine	increases expression	ISO	RGD:2322961	6480464	Glucosamine results in increased expression of DDIT4L mRNA	CTD	PMID:17109745
DDIT4L	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of DDIT4L mRNA	CTD	PMID:21934132
DDIT4L	Human	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of DDIT4L mRNA	CTD	PMID:23830798
DDIT4L	Human	alpha-Zearalanol	multiple interactions	ISO	RGD:2322961	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of DDIT4L mRNA	CTD	PMID:35163327
DDIT4L	Human	alpha-Zearalanol	decreases expression	ISO	RGD:2322961	6480464	Zeranol results in decreased expression of DDIT4L mRNA	CTD	PMID:35163327
DDIT4L	Human	ammonium chloride	affects expression	ISO	RGD:2322961	6480464	Ammonium Chloride affects the expression of DDIT4L mRNA	CTD	PMID:16483693
DDIT4L	Human	atrazine	decreases expression	ISO	RGD:2322961	6480464	Atrazine results in decreased expression of DDIT4L mRNA	CTD	PMID:36841081
DDIT4L	Human	atrazine	affects methylation	ISO	RGD:2322961	6480464	Atrazine affects the methylation of DDIT4L gene	CTD	PMID:35440735
DDIT4L	Human	benzo[a]pyrene	increases expression	ISO	RGD:733457	6480464	Benzo(a)pyrene results in increased expression of DDIT4L mRNA	CTD	PMID:15034205\|PMID:19770486\|PMID:21569818\|PMID:21715664\|PMID:21964900\|PMID:22610609\|PMID:23735875
DDIT4L	Human	benzo[a]pyrene	affects methylation	EXP		6480464	Benzo(a)pyrene affects the methylation of DDIT4L promoter	CTD	PMID:27901495
DDIT4L	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of DDIT4L 5' UTR	CTD	PMID:27901495
DDIT4L	Human	benzo[a]pyrene	multiple interactions	ISO	RGD:733457	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
DDIT4L	Human	benzo[a]pyrene	increases expression	ISO	RGD:2322961	6480464	Benzo(a)pyrene results in increased expression of DDIT4L mRNA	CTD	PMID:21839799
DDIT4L	Human	benzo[b]fluoranthene	increases expression	ISO	RGD:733457	6480464	benzo(b)fluoranthene results in increased expression of DDIT4L mRNA	CTD	PMID:26377693
DDIT4L	Human	benzo[b]fluoranthene	multiple interactions	ISO	RGD:733457	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
DDIT4L	Human	beta-D-glucosamine	increases expression	ISO	RGD:2322961	6480464	Glucosamine results in increased expression of DDIT4L mRNA	CTD	PMID:17109745
DDIT4L	Human	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:733457	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ...	CTD	PMID:39150890
DDIT4L	Human	bisphenol A	affects expression	ISO	RGD:2322961	6480464	bisphenol A affects the expression of DDIT4L mRNA	CTD	PMID:25181051
DDIT4L	Human	bisphenol A	decreases expression	ISO	RGD:2322961	6480464	bisphenol A results in decreased expression of DDIT4L mRNA	CTD	PMID:18180321
DDIT4L	Human	Butylbenzyl phthalate	multiple interactions	ISO	RGD:733457	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ...	CTD	PMID:39150890
DDIT4L	Human	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DDIT4L more ...	CTD	PMID:35301059
DDIT4L	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of DDIT4L mRNA	CTD	PMID:38382870
DDIT4L	Human	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DDIT4L more ...	CTD	PMID:35301059
DDIT4L	Human	cadmium sulfate	increases expression	ISO	RGD:733457	6480464	cadmium sulfate results in increased expression of DDIT4L mRNA	CTD	PMID:16221973
DDIT4L	Human	camptothecin	increases expression	EXP		6480464	Camptothecin results in increased expression of DDIT4L mRNA	CTD	PMID:38460933
DDIT4L	Human	carbamazepine	affects expression	EXP		6480464	Carbamazepine affects the expression of DDIT4L mRNA	CTD	PMID:25979313
DDIT4L	Human	cefaloridine	increases expression	ISO	RGD:2322961	6480464	Cephaloridine results in increased expression of DDIT4L mRNA	CTD	PMID:18500788
DDIT4L	Human	chloroprene	increases expression	ISO	RGD:733457	6480464	Chloroprene results in increased expression of DDIT4L mRNA	CTD	PMID:23125180
DDIT4L	Human	choline	multiple interactions	ISO	RGD:733457	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
DDIT4L	Human	chrysene	multiple interactions	ISO	RGD:733457	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
DDIT4L	Human	cisplatin	increases expression	ISO	RGD:733457	6480464	Cisplatin results in increased expression of DDIT4L mRNA	CTD	PMID:25270620
DDIT4L	Human	cisplatin	increases expression	ISO	RGD:2322961	6480464	Cisplatin results in increased expression of DDIT4L mRNA	CTD	PMID:22023808
DDIT4L	Human	copper atom	decreases expression	ISO	RGD:2322961	6480464	Copper results in decreased expression of DDIT4L mRNA	CTD	PMID:30556269
DDIT4L	Human	copper(0)	decreases expression	ISO	RGD:2322961	6480464	Copper results in decreased expression of DDIT4L mRNA	CTD	PMID:30556269
DDIT4L	Human	coumarin	increases expression	ISO	RGD:2322961	6480464	coumarin results in increased expression of DDIT4L mRNA	CTD	PMID:18480146
DDIT4L	Human	Cuprizon	decreases expression	ISO	RGD:2322961	6480464	Cuprizone results in decreased expression of DDIT4L mRNA	CTD	PMID:26577399
DDIT4L	Human	curcumin	decreases expression	EXP		6480464	Curcumin results in decreased expression of DDIT4L mRNA	CTD	PMID:17999991
DDIT4L	Human	curcumin	increases expression	ISO	RGD:2322961	6480464	Curcumin results in increased expression of DDIT4L mRNA	CTD	PMID:18299980
DDIT4L	Human	cyclosporin A	decreases expression	ISO	RGD:2322961	6480464	Cyclosporine results in decreased expression of DDIT4L mRNA	CTD	PMID:21865292
DDIT4L	Human	diallyl trisulfide	increases expression	ISO	RGD:2322961	6480464	diallyl trisulfide results in increased expression of DDIT4L mRNA	CTD	PMID:34014027
DDIT4L	Human	dibenz[a,h]anthracene	increases expression	ISO	RGD:733457	6480464	1,2,5,6-dibenzanthracene results in increased expression of DDIT4L mRNA	CTD	PMID:26377693
DDIT4L	Human	dibutyl phthalate	increases expression	ISO	RGD:2322961	6480464	Dibutyl Phthalate results in increased expression of DDIT4L mRNA	CTD	PMID:21266533
DDIT4L	Human	dibutyl phthalate	multiple interactions	ISO	RGD:733457	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ...	CTD	PMID:39150890
DDIT4L	Human	diethyl maleate	increases expression	ISO	RGD:733457	6480464	diethyl maleate results in increased expression of DDIT4L mRNA	CTD	PMID:25270620
DDIT4L	Human	diethyl phthalate	multiple interactions	ISO	RGD:733457	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ...	CTD	PMID:39150890
DDIT4L	Human	diethylstilbestrol	decreases expression	ISO	RGD:2322961	6480464	Diethylstilbestrol results in decreased expression of DDIT4L mRNA	CTD	PMID:21658437
DDIT4L	Human	diisobutyl phthalate	multiple interactions	ISO	RGD:733457	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ...	CTD	PMID:39150890
DDIT4L	Human	diisononyl phthalate	multiple interactions	ISO	RGD:733457	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ...	CTD	PMID:39150890
DDIT4L	Human	disodium selenite	decreases expression	EXP		6480464	Sodium Selenite results in decreased expression of DDIT4L mRNA	CTD	PMID:18175754
DDIT4L	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
DDIT4L	Human	endosulfan	increases expression	ISO	RGD:2322961	6480464	Endosulfan results in increased expression of DDIT4L mRNA	CTD	PMID:29391264
DDIT4L	Human	entinostat	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
DDIT4L	Human	entinostat	decreases expression	EXP		6480464	entinostat results in decreased expression of DDIT4L mRNA	CTD	PMID:26272509
DDIT4L	Human	ethanol	multiple interactions	ISO	RGD:733457	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of DDIT4L mRNA	CTD	PMID:30517762
DDIT4L	Human	flutamide	increases expression	ISO	RGD:2322961	6480464	Flutamide results in increased expression of DDIT4L mRNA	CTD	PMID:24136188
DDIT4L	Human	folic acid	multiple interactions	ISO	RGD:733457	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
DDIT4L	Human	formaldehyde	decreases expression	ISO	RGD:733457	6480464	Formaldehyde results in decreased expression of DDIT4L mRNA	CTD	PMID:33233951
DDIT4L	Human	furan	increases methylation	ISO	RGD:2322961	6480464	furan results in increased methylation of DDIT4L gene	CTD	PMID:22079235
DDIT4L	Human	furan	increases expression	ISO	RGD:2322961	6480464	furan results in increased expression of DDIT4L mRNA	CTD	PMID:25539665
DDIT4L	Human	furan	increases expression	ISO	RGD:733457	6480464	furan results in increased expression of DDIT4L mRNA	CTD	PMID:24183702\|PMID:37517673
DDIT4L	Human	glycidol	increases expression	ISO	RGD:2322961	6480464	glycidol results in increased expression of DDIT4L mRNA	CTD	PMID:24915197
DDIT4L	Human	hydroxyurea	increases expression	ISO	RGD:733457	6480464	Hydroxyurea results in increased expression of DDIT4L mRNA	CTD	PMID:27208086
DDIT4L	Human	inulin	multiple interactions	ISO	RGD:733457	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DDIT4L mRNA	CTD	PMID:36331819
DDIT4L	Human	L-methionine	multiple interactions	ISO	RGD:733457	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
DDIT4L	Human	leflunomide	increases expression	ISO	RGD:733457	6480464	leflunomide results in increased expression of DDIT4L mRNA	CTD	PMID:19751817
DDIT4L	Human	lipopolysaccharide	multiple interactions	EXP		6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DDIT4L mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
DDIT4L	Human	lipopolysaccharide	decreases expression	EXP		6480464	Lipopolysaccharides results in decreased expression of DDIT4L mRNA	CTD	PMID:35811015
DDIT4L	Human	menadione	increases expression	ISO	RGD:733457	6480464	Vitamin K 3 results in increased expression of DDIT4L mRNA	CTD	PMID:25270620
DDIT4L	Human	metformin	multiple interactions	EXP		6480464	[Metformin co-treated with Pioglitazone] results in increased expression of DDIT4L mRNA	CTD	PMID:32589349
DDIT4L	Human	methapyrilene	increases expression	ISO	RGD:2322961	6480464	Methapyrilene results in increased expression of DDIT4L mRNA	CTD	PMID:28935588
DDIT4L	Human	methylmercury chloride	decreases expression	EXP		6480464	methylmercuric chloride results in decreased expression of DDIT4L mRNA	CTD	PMID:28001369
DDIT4L	Human	microcystin-LR	increases expression	ISO	RGD:733457	6480464	cyanoginosin LR results in increased expression of DDIT4L mRNA	CTD	PMID:17654400
DDIT4L	Human	mitomycin C	increases expression	ISO	RGD:733457	6480464	Mitomycin results in increased expression of DDIT4L mRNA	CTD	PMID:25270620
DDIT4L	Human	mono(2-ethylhexyl) phthalate	increases expression	EXP		6480464	mono-(2-ethylhexyl)phthalate results in increased expression of DDIT4L mRNA	CTD	PMID:36695872
DDIT4L	Human	N-methyl-N-nitrosourea	increases expression	ISO	RGD:733457	6480464	Methylnitrosourea results in increased expression of DDIT4L mRNA	CTD	PMID:25270620
DDIT4L	Human	N-nitrosodiethylamine	increases expression	ISO	RGD:733457	6480464	Diethylnitrosamine results in increased expression of DDIT4L mRNA	CTD	PMID:21607683\|PMID:24535843
DDIT4L	Human	N-nitrosodiethylamine	increases expression	ISO	RGD:2322961	6480464	Diethylnitrosamine results in increased expression of DDIT4L mRNA	CTD	PMID:19638242
DDIT4L	Human	N-nitrosodiethylamine	multiple interactions	ISO	RGD:2322961	6480464	[Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of DDIT4L mRNA	CTD	PMID:28943392
DDIT4L	Human	nickel atom	decreases expression	EXP		6480464	Nickel results in decreased expression of DDIT4L mRNA	CTD	PMID:24768652\|PMID:25583101
DDIT4L	Human	okadaic acid	increases expression	EXP		6480464	Okadaic Acid results in increased expression of DDIT4L mRNA	CTD	PMID:38832940
DDIT4L	Human	p-chloromercuribenzoic acid	decreases expression	EXP		6480464	p-Chloromercuribenzoic Acid results in decreased expression of DDIT4L mRNA	CTD	PMID:26272509
DDIT4L	Human	p-chloromercuribenzoic acid	multiple interactions	EXP		6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
DDIT4L	Human	paracetamol	affects expression	ISO	RGD:733457	6480464	Acetaminophen affects the expression of DDIT4L mRNA	CTD	PMID:17562736
DDIT4L	Human	paracetamol	increases expression	ISO	RGD:2322961	6480464	Acetaminophen results in increased expression of DDIT4L mRNA	CTD	PMID:30723492
DDIT4L	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:733457	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DDIT4L mRNA	CTD	PMID:36331819
DDIT4L	Human	perfluorooctanoic acid	multiple interactions	ISO	RGD:2322961	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of DDIT4L mRNA	CTD	PMID:35163327
DDIT4L	Human	phenylmercury acetate	decreases expression	EXP		6480464	Phenylmercuric Acetate results in decreased expression of DDIT4L mRNA	CTD	PMID:26272509
DDIT4L	Human	phenylmercury acetate	multiple interactions	EXP		6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
DDIT4L	Human	pioglitazone	increases expression	EXP		6480464	Pioglitazone results in increased expression of DDIT4L mRNA	CTD	PMID:32589349
DDIT4L	Human	pioglitazone	multiple interactions	EXP		6480464	[Metformin co-treated with Pioglitazone] results in increased expression of DDIT4L mRNA	CTD	PMID:32589349
DDIT4L	Human	pirinixic acid	increases expression	ISO	RGD:733457	6480464	pirinixic acid results in increased expression of DDIT4L mRNA	CTD	PMID:20813756\|PMID:23811191
DDIT4L	Human	quercetin	affects expression	ISO	RGD:2322961	6480464	Quercetin affects the expression of DDIT4L mRNA	CTD	PMID:18178720
DDIT4L	Human	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	EXP		6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DDIT4L mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
DDIT4L	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
DDIT4L	Human	silicon dioxide	decreases expression	EXP		6480464	Silicon Dioxide analog results in decreased expression of DDIT4L mRNA	CTD	PMID:25895662
DDIT4L	Human	silicon dioxide	increases expression	EXP		6480464	Silicon Dioxide analog results in increased expression of DDIT4L mRNA	CTD	PMID:23806026
DDIT4L	Human	sirolimus	decreases expression	ISO	RGD:2322961	6480464	Sirolimus results in decreased expression of DDIT4L mRNA	CTD	PMID:21865292
DDIT4L	Human	sirolimus	increases expression	ISO	RGD:2322961	6480464	Sirolimus results in increased expression of DDIT4L mRNA	CTD	PMID:21865292
DDIT4L	Human	sodium arsenite	increases expression	ISO	RGD:733457	6480464	sodium arsenite results in increased expression of DDIT4L mRNA	CTD	PMID:25270620
DDIT4L	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of DDIT4L mRNA	CTD	PMID:38568856
DDIT4L	Human	Soman	decreases expression	ISO	RGD:2322961	6480464	Soman results in decreased expression of DDIT4L mRNA	CTD	PMID:19281266
DDIT4L	Human	sotorasib	multiple interactions	EXP		6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DDIT4L mRNA	CTD	PMID:36139627
DDIT4L	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of DDIT4L mRNA	CTD	PMID:31533062
DDIT4L	Human	tacrolimus hydrate	decreases expression	ISO	RGD:2322961	6480464	Tacrolimus results in decreased expression of DDIT4L mRNA	CTD	PMID:21865292
DDIT4L	Human	testosterone	affects expression	ISO	RGD:733457	6480464	Testosterone affects the expression of DDIT4L mRNA	CTD	PMID:20403060
DDIT4L	Human	testosterone	decreases expression	ISO	RGD:733457	6480464	Testosterone results in decreased expression of DDIT4L mRNA	CTD	PMID:20403060
DDIT4L	Human	tetrachloromethane	multiple interactions	ISO	RGD:733457	6480464	[Carbon Tetrachloride co-treated with Ethanol] results in increased expression of DDIT4L mRNA	CTD	PMID:30517762
DDIT4L	Human	tetrachloromethane	increases expression	ISO	RGD:2322961	6480464	Carbon Tetrachloride results in increased expression of DDIT4L mRNA	CTD	PMID:31150632
DDIT4L	Human	tetraphene	multiple interactions	ISO	RGD:733457	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
DDIT4L	Human	thioacetamide	increases expression	ISO	RGD:2322961	6480464	Thioacetamide results in increased expression of DDIT4L mRNA	CTD	PMID:23411599\|PMID:34492290
DDIT4L	Human	thioacetamide	multiple interactions	ISO	RGD:2322961	6480464	[Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of DDIT4L mRNA	CTD	PMID:28943392
DDIT4L	Human	titanium dioxide	decreases expression	ISO	RGD:733457	6480464	titanium dioxide results in decreased expression of DDIT4L mRNA	CTD	PMID:23557971
DDIT4L	Human	titanium dioxide	decreases methylation	ISO	RGD:733457	6480464	titanium dioxide results in decreased methylation of DDIT4L gene	CTD	PMID:35295148
DDIT4L	Human	trametinib	multiple interactions	EXP		6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DDIT4L mRNA	CTD	PMID:36139627
DDIT4L	Human	trichloroethene	increases expression	ISO	RGD:2322961	6480464	Trichloroethylene results in increased expression of DDIT4L mRNA	CTD	PMID:33387578
DDIT4L	Human	trichostatin A	decreases expression	EXP		6480464	trichostatin A results in decreased expression of DDIT4L mRNA	CTD	PMID:24935251\|PMID:26272509
DDIT4L	Human	trichostatin A	multiple interactions	EXP		6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
DDIT4L	Human	triclosan	decreases expression	EXP		6480464	Triclosan results in decreased expression of DDIT4L mRNA	CTD	PMID:30510588
DDIT4L	Human	trimellitic anhydride	decreases expression	ISO	RGD:733457	6480464	trimellitic anhydride results in decreased expression of DDIT4L mRNA	CTD	PMID:19042947
DDIT4L	Human	triphenyl phosphate	affects expression	ISO	RGD:2322961	6480464	triphenyl phosphate affects the expression of DDIT4L mRNA	CTD	PMID:30589522
DDIT4L	Human	Triptolide	increases expression	ISO	RGD:733457	6480464	triptolide results in increased expression of DDIT4L mRNA	CTD	PMID:32835833
DDIT4L	Human	triptonide	increases expression	ISO	RGD:733457	6480464	triptonide results in increased expression of DDIT4L mRNA	CTD	PMID:33045310
DDIT4L	Human	valproic acid	decreases methylation	EXP		6480464	Valproic Acid results in decreased methylation of DDIT4L gene	CTD	PMID:29154799
DDIT4L	Human	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of DDIT4L mRNA	CTD	PMID:23179753\|PMID:26272509
DDIT4L	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of DDIT4L mRNA	CTD	PMID:19101580\|PMID:27188386\|PMID:28001369
DDIT4L	Human	valproic acid	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
DDIT4L	Human	zearalenone	decreases expression	EXP		6480464	Zearalenone results in decreased expression of DDIT4L mRNA	CTD	PMID:36828454
DDIT4L	Human	zoledronic acid	increases expression	EXP		6480464	zoledronic acid results in increased expression of DDIT4L mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
DDIT4L	Human	negative regulation of signal transduction	involved_in	IEA	InterPro:IPR012918	150520179		InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
DDIT4L	Human	cytoplasm	located_in	IEA	InterPro:IPR012918	150520179		InterPro	GO_REF:0000002
DDIT4L	Human	cytoplasm	located_in	ISS	UniProtKB:Q9NX09	150520179		UniProt	GO_REF:0000024
DDIT4L	Human	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	150520179		UniProt	GO_REF:0000044
DDIT4L	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
DDIT4L	Human	protein binding	enables	IPI	UniProtKB:P0C1Z6	150520179	PMID:27107012	IntAct	PMID:27107012
DDIT4L	Human	protein binding	enables	IPI	UniProtKB:P62308	150520179	PMID:16189514	IntAct	PMID:16189514
DDIT4L	Human	protein binding	enables	IPI	UniProtKB:P62308\|UniProtKB:Q13137\|UniProtKB:Q15014\|UniProtKB:Q9UK45	150520179	PMID:25416956	IntAct	PMID:25416956
DDIT4L	Human	protein binding	enables	IPI	UniProtKB:O00204\|UniProtKB:O00488\|UniProtKB:O14525-2\|UniProtKB:O14796\|UniProtKB:O15197-2\|UniProtKB:O15479\|UniProtKB:O43598\|UniProtKB:O43681\|UniProtKB:O43741\|UniProtKB:O60880\|UniProtKB:O75344\|UniProtKB:O75400-2\|UniProtKB:O75419\|UniProtKB:O75679\|UniProtKB:O75716\|UniProtKB:O75909-2\|UniProtKB:O76011\|UniProtKB:O76064\|UniProtKB:O95257\|UniProtKB:O95342\|UniProtKB:O95429\|UniProtKB:O95833\|UniProtKB:O95989\|UniProtKB:P07108-2\|UniProtKB:P07947\|UniProtKB:P09012\|UniProtKB:P0CB47\|UniProtKB:P0CG21\|UniProtKB:P10599\|UniProtKB:P16083\|UniProtKB:P16118\|UniProtKB:P20839-3\|UniProtKB:P21333-2\|UniProtKB:P25786\|UniProtKB:P25800\|UniProtKB:P28065\|UniProtKB:P28069\|UniProtKB:P31749\|UniProtKB:P32320\|UniProtKB:P35268\|UniProtKB:P36508\|UniProtKB:P38919\|UniProtKB:P40937\|UniProtKB:P41227\|UniProtKB:P41240\|UniProtKB:P43080\|UniProtKB:P47929\|UniProtKB:P49247\|UniProtKB:P49760\|UniProtKB:P49761\|UniProtKB:P49789\|UniProtKB:P50583\|UniProtKB:P51687\|UniProtKB:P51946\|UniProtKB:P53674\|UniProtKB:P55273\|UniProtKB:P55735-3\|UniProtKB:P55957\|UniProtKB:P56279\|UniProtKB:P57075-2\|UniProtKB:P57077-4\|UniProtKB:P57721-2\|UniProtKB:P60660\|UniProtKB:P60891\|UniProtKB:P61758\|UniProtKB:P62308\|UniProtKB:P62310\|UniProtKB:P62699\|UniProtKB:P62993\|UniProtKB:P63146\|UniProtKB:P78358\|UniProtKB:P83876\|UniProtKB:Q03393\|UniProtKB:Q05D60\|UniProtKB:Q08493-2\|UniProtKB:Q10570\|UniProtKB:Q12765-2\|UniProtKB:Q13043-2\|UniProtKB:Q13064\|UniProtKB:Q13158\|UniProtKB:Q13541\|UniProtKB:Q13637\|UniProtKB:Q14119\|UniProtKB:Q14192\|UniProtKB:Q14240-2\|UniProtKB:Q15014\|UniProtKB:Q15056-2\|UniProtKB:Q15126\|UniProtKB:Q15555\|UniProtKB:Q15915\|UniProtKB:Q32P44\|UniProtKB:Q3MJ62\|UniProtKB:Q3SXR9\|UniProtKB:Q3ZCW2\|UniProtKB:Q49AR2\|UniProtKB:Q5VVQ6\|UniProtKB:Q63HM1\|UniProtKB:Q63ZY3	150520179	PMID:32296183	IntAct	PMID:32296183
DDIT4L	Human	protein binding	enables	IPI	UniProtKB:Q68J44\|UniProtKB:Q6IPR3\|UniProtKB:Q6L8G9\|UniProtKB:Q6NVV7\|UniProtKB:Q6NZ36-4\|UniProtKB:Q6TGC4\|UniProtKB:Q6ZYL4\|UniProtKB:Q7L273\|UniProtKB:Q7L2R6-2\|UniProtKB:Q7Z6K5\|UniProtKB:Q7Z7H3\|UniProtKB:Q86UV6-2\|UniProtKB:Q86VK4-3\|UniProtKB:Q86WC6\|UniProtKB:Q86WQ0\|UniProtKB:Q86WT6-2\|UniProtKB:Q8IUI8\|UniProtKB:Q8IWB6\|UniProtKB:Q8IYS1\|UniProtKB:Q8IZ13\|UniProtKB:Q8N0Z6\|UniProtKB:Q8N339\|UniProtKB:Q8N371-3\|UniProtKB:Q8N9Q2\|UniProtKB:Q8NEY1-3\|UniProtKB:Q8TCE9\|UniProtKB:Q8TDX7\|UniProtKB:Q8TEW6\|UniProtKB:Q8WUI4-6\|UniProtKB:Q8WW01\|UniProtKB:Q8WW24\|UniProtKB:Q8WXD5\|UniProtKB:Q8WY64\|UniProtKB:Q8WYJ6\|UniProtKB:Q92673\|UniProtKB:Q92917\|UniProtKB:Q969H8\|UniProtKB:Q969Y2\|UniProtKB:Q96B23\|UniProtKB:Q96B26\|UniProtKB:Q96BJ3\|UniProtKB:Q96BZ8\|UniProtKB:Q96CD2\|UniProtKB:Q96G61\|UniProtKB:Q96HD9\|UniProtKB:Q96IW7\|UniProtKB:Q96KB5\|UniProtKB:Q96KN1\|UniProtKB:Q96LK0\|UniProtKB:Q96MF2\|UniProtKB:Q96PN8\|UniProtKB:Q99633\|UniProtKB:Q99697-2\|UniProtKB:Q99719\|UniProtKB:Q9BRQ3\|UniProtKB:Q9BRT3\|UniProtKB:Q9BVJ7\|UniProtKB:Q9BW92\|UniProtKB:Q9BZQ8\|UniProtKB:Q9BZR8\|UniProtKB:Q9GZM8\|UniProtKB:Q9H0E2\|UniProtKB:Q9H257-2\|UniProtKB:Q9H299\|UniProtKB:Q9H503-2\|UniProtKB:Q9H773\|UniProtKB:Q9HB07\|UniProtKB:Q9HBI0\|UniProtKB:Q9HC98-4\|UniProtKB:Q9HD42\|UniProtKB:Q9NP66\|UniProtKB:Q9NP86\|UniProtKB:Q9NPG2\|UniProtKB:Q9NPJ8-3\|UniProtKB:Q9NQG5\|UniProtKB:Q9NQT4\|UniProtKB:Q9NQW7-3\|UniProtKB:Q9NR81\|UniProtKB:Q9NRQ2\|UniProtKB:Q9NU19\|UniProtKB:Q9NUJ3\|UniProtKB:Q9NWQ9\|UniProtKB:Q9P202\|UniProtKB:Q9UBH0\|UniProtKB:Q9UBL6-2\|UniProtKB:Q9UBU8-2\|UniProtKB:Q9UBY9\|UniProtKB:Q9UFG5\|UniProtKB:Q9UH03\|UniProtKB:Q9UH92-3\|UniProtKB:Q9UHX1-2\|UniProtKB:Q9UI47-2\|UniProtKB:Q9UIL1-3\|UniProtKB:Q9UK45\|UniProtKB:Q9ULP0-2\|UniProtKB:Q9UPY8\|UniProtKB:Q9Y242	150520179	PMID:32296183	IntAct	PMID:32296183
DDIT4L	Human	protein binding	enables	IPI	UniProtKB:P07237\|UniProtKB:P62308	150520179	PMID:32814053	IntAct	PMID:32814053
DDIT4L	Human	protein binding	enables	IPI	UniProtKB:Q9UK45	150520179	PMID:31515488	IntAct	PMID:31515488
DDIT4L	Human	protein binding	enables	IPI	UniProtKB:Q9Y263\|UniProtKB:Q9Y316\|UniProtKB:Q9Y3B2\|UniProtKB:Q9Y3C6\|UniProtKB:Q9Y4Y9\|UniProtKB:Q9Y5B8\|UniProtKB:Q9Y6C2-2	150520179	PMID:32296183	IntAct	PMID:32296183

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
2.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:12453409	PMID:14702039	PMID:15308555	PMID:15632201	PMID:16189514	PMID:16344560	PMID:17207965	PMID:19268525	PMID:19491193	PMID:19616115	PMID:25416956	PMID:25814554
PMID:26030842	PMID:27107012	PMID:27107014	PMID:28246202	PMID:28514442	PMID:31515488	PMID:32296183	PMID:32814053	PMID:33961781	PMID:35914814	PMID:36217029

DDIT4L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	100,185,870 - 100,190,468 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	100,185,870 - 100,190,782 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	101,107,027 - 101,111,625 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	101,326,050 - 101,330,636 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	101,464,206 - 101,468,791	NCBI
Celera	4	98,405,052 - 98,409,638 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI
HuRef	4	96,845,264 - 96,850,266 (-)	NCBI		HuRef
CHM1_1	4	101,083,602 - 101,088,230 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	103,501,503 - 103,506,101 (-)	NCBI		T2T-CHM13v2.0

Ddit4l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	137,329,433 - 137,334,093 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	137,327,373 - 137,334,094 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	137,623,672 - 137,628,332 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	137,621,612 - 137,628,333 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	137,286,636 - 137,291,296 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	137,561,123 - 137,565,719 (+)	NCBI		MGSCv36	mm8
Celera	3	144,044,354 - 144,049,027 (+)	NCBI		Celera
Cytogenetic Map	3	G3	NCBI
cM Map	3	63.81	NCBI

Ddit4l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	228,800,831 - 228,804,478 (+)	NCBI		GRCr8
mRatBN7.2	2	226,128,273 - 226,131,044 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	226,128,276 - 226,131,375 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	233,871,078 - 233,873,849 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	231,770,838 - 231,773,609 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	226,635,456 - 226,638,227 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	242,882,219 - 242,885,088 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	242,882,306 - 242,885,131 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	261,430,156 - 261,433,647 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	235,130,697 - 235,133,417 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	218,297,989 - 218,300,862 (+)	NCBI		Celera
Cytogenetic Map	2	q43	NCBI

Ddit4l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955496	7,618,731 - 7,622,180 (+)	NCBI	ChiLan1.0	ChiLan1.0

DDIT4L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	98,264,882 - 98,273,862 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	98,551,071 - 98,560,055 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	92,606,473 - 92,615,421 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	103,268,048 - 103,272,666 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	103,268,048 - 103,272,666 (-)	Ensembl	panpan1.1		panPan2

DDIT4L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	22,062,630 - 22,067,364 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	22,064,393 - 22,068,562 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	19,827,798 - 19,833,447 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	22,284,651 - 22,290,302 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	22,283,572 - 22,289,375 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	22,261,135 - 22,266,777 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	22,046,970 - 22,052,613 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	17,814,385 - 17,820,036 (+)	NCBI		UU_Cfam_GSD_1.0

Ddit4l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	19,480,437 - 19,485,057 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936520	2,823,885 - 2,828,698 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936520	2,823,896 - 2,828,687 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDIT4L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	120,371,769 - 120,376,441 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	120,371,724 - 120,376,444 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	129,550,404 - 129,555,119 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDIT4L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	48,311,147 - 48,315,706 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	48,311,161 - 48,315,630 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	26,785,094 - 26,790,407 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in DDIT4L
18 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 4q22.2-32.3(chr4:92913386-165299707)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051775]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051775]\|See cases [RCV000051775]	Chr4:92913386..165299707 [GRCh38] Chr4:93834537..166220859 [GRCh37] Chr4:94053560..166440309 [NCBI36] Chr4:4q22.2-32.3	pathogenic
GRCh38/hg38 4q22.3-28.3(chr4:96092893-136410207)x3	copy number gain	See cases [RCV000051776]	Chr4:96092893..136410207 [GRCh38] Chr4:97014044..137331362 [GRCh37] Chr4:97233067..137550812 [NCBI36] Chr4:4q22.3-28.3	pathogenic
GRCh38/hg38 4q21.21-24(chr4:80427023-100855441)x1	copy number loss	See cases [RCV000137269]	Chr4:80427023..100855441 [GRCh38] Chr4:81348177..101776598 [GRCh37] Chr4:81567201..101995621 [NCBI36] Chr4:4q21.21-24	pathogenic
GRCh38/hg38 4q22.1-24(chr4:92610413-101521991)x1	copy number loss	See cases [RCV000140412]	Chr4:92610413..101521991 [GRCh38] Chr4:93531564..102443148 [GRCh37] Chr4:93750587..102662171 [NCBI36] Chr4:4q22.1-24	pathogenic
GRCh38/hg38 4q23-24(chr4:100021886-100301285)x1	copy number loss	See cases [RCV000143561]	Chr4:100021886..100301285 [GRCh38] Chr4:100943043..101222442 [GRCh37] Chr4:101162066..101441465 [NCBI36] Chr4:4q23-24	likely benign\|uncertain significance
GRCh37/hg19 4p16.3-q35.2(chr4:12440-190904441)x3	copy number gain	See cases [RCV000446653]	Chr4:12440..190904441 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q21.23-24(chr4:85805268-103678797)x1	copy number loss	See cases [RCV000445741]	Chr4:85805268..103678797 [GRCh37] Chr4:4q21.23-24	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:68346-190957473)	copy number gain	See cases [RCV000510453]	Chr4:68346..190957473 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q22.1-24(chr4:92201567-103043808)x1	copy number loss	See cases [RCV000511194]	Chr4:92201567..103043808 [GRCh37] Chr4:4q22.1-24	pathogenic
GRCh37/hg19 4q22.1-35.2(chr4:93071152-190957473)x3	copy number gain	See cases [RCV000510970]	Chr4:93071152..190957473 [GRCh37] Chr4:4q22.1-35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:68346-190957473)x3	copy number gain	See cases [RCV000512241]	Chr4:68346..190957473 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:49450-190915650)x3	copy number gain	not provided [RCV000743155]	Chr4:49450..190915650 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:49450-190963766)x3	copy number gain	not provided [RCV000743156]	Chr4:49450..190963766 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4p16.3-q35.2(chr4:11525-191028879)x3	copy number gain	not provided [RCV000743147]	Chr4:11525..191028879 [GRCh37] Chr4:4p16.3-q35.2	pathogenic
GRCh37/hg19 4q22.2-24(chr4:94692345-101308220)x1	copy number loss	not provided [RCV001259285]	Chr4:94692345..101308220 [GRCh37] Chr4:4q22.2-24	likely pathogenic
GRCh37/hg19 4q22.3-25(chr4:95490755-109977216)x3	copy number gain	not provided [RCV001827745]	Chr4:95490755..109977216 [GRCh37] Chr4:4q22.3-25	likely pathogenic
GRCh37/hg19 4q12-31.21(chr4:52866944-143582507)x3	copy number gain	not provided [RCV001827738]	Chr4:52866944..143582507 [GRCh37] Chr4:4q12-31.21	pathogenic
NM_145244.4(DDIT4L):c.310C>G (p.Arg104Gly)	single nucleotide variant	not specified [RCV004308576]	Chr4:100187949 [GRCh38] Chr4:101109106 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.73C>T (p.Pro25Ser)	single nucleotide variant	not specified [RCV004089031]	Chr4:100189911 [GRCh38] Chr4:101111068 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.530T>C (p.Val177Ala)	single nucleotide variant	not specified [RCV004117465]	Chr4:100187729 [GRCh38] Chr4:101108886 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.314G>T (p.Gly105Val)	single nucleotide variant	not specified [RCV004170043]	Chr4:100187945 [GRCh38] Chr4:101109102 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.209A>T (p.Gln70Leu)	single nucleotide variant	not specified [RCV004107822]	Chr4:100188050 [GRCh38] Chr4:101109207 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.371T>C (p.Ile124Thr)	single nucleotide variant	not specified [RCV004115695]	Chr4:100187888 [GRCh38] Chr4:101109045 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.137A>G (p.Glu46Gly)	single nucleotide variant	not specified [RCV004324134]	Chr4:100188122 [GRCh38] Chr4:101109279 [GRCh37] Chr4:4q24	uncertain significance
GRCh37/hg19 4q23-24(chr4:100542119-103793167)x1	copy number loss	not provided [RCV003485432]	Chr4:100542119..103793167 [GRCh37] Chr4:4q23-24	pathogenic
GRCh37/hg19 4q23-24(chr4:100980656-101197518)x3	copy number gain	not provided [RCV003484195]	Chr4:100980656..101197518 [GRCh37] Chr4:4q23-24	uncertain significance
GRCh37/hg19 4q23-24(chr4:99355670-107274288)x1	copy number loss	not specified [RCV003986486]	Chr4:99355670..107274288 [GRCh37] Chr4:4q23-24	pathogenic
GRCh37/hg19 4q23-25(chr4:100172302-107880077)x1	copy number loss	not specified [RCV003986501]	Chr4:100172302..107880077 [GRCh37] Chr4:4q23-25	pathogenic
NM_145244.4(DDIT4L):c.186G>T (p.Glu62Asp)	single nucleotide variant	not specified [RCV004375573]	Chr4:100188073 [GRCh38] Chr4:101109230 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.293C>T (p.Thr98Met)	single nucleotide variant	not specified [RCV004375574]	Chr4:100187966 [GRCh38] Chr4:101109123 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.392T>C (p.Val131Ala)	single nucleotide variant	not specified [RCV004375576]	Chr4:100187867 [GRCh38] Chr4:101109024 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.37G>A (p.Ala13Thr)	single nucleotide variant	not specified [RCV004375575]	Chr4:100189947 [GRCh38] Chr4:101111104 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.465T>G (p.Phe155Leu)	single nucleotide variant	not specified [RCV004375577]	Chr4:100187794 [GRCh38] Chr4:101108951 [GRCh37] Chr4:4q24	uncertain significance
GRCh37/hg19 4p12-q35.2(chr4:45455621-191003541)x3	copy number gain	not provided [RCV003885507]	Chr4:45455621..191003541 [GRCh37] Chr4:4p12-q35.2	pathogenic
NM_145244.4(DDIT4L):c.563C>T (p.Thr188Ile)	single nucleotide variant	not specified [RCV004611549]	Chr4:100187696 [GRCh38] Chr4:101108853 [GRCh37] Chr4:4q24	uncertain significance
GRCh37/hg19 4q23-24(chr4:100883715-101871025)x1	copy number loss	not provided [RCV004819766]	Chr4:100883715..101871025 [GRCh37] Chr4:4q23-24	uncertain significance
NM_145244.4(DDIT4L):c.136G>A (p.Glu46Lys)	single nucleotide variant	not specified [RCV004906142]	Chr4:100188123 [GRCh38] Chr4:101109280 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.511A>G (p.Ser171Gly)	single nucleotide variant	not specified [RCV004906143]	Chr4:100187748 [GRCh38] Chr4:101108905 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.265G>A (p.Ala89Thr)	single nucleotide variant	not specified [RCV004906144]	Chr4:100187994 [GRCh38] Chr4:101109151 [GRCh37] Chr4:4q24	uncertain significance
NM_145244.4(DDIT4L):c.556G>C (p.Gly186Arg)	single nucleotide variant	not specified [RCV004906145]	Chr4:100187703 [GRCh38] Chr4:101108860 [GRCh37] Chr4:4q24	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	791
Count of miRNA genes:	579
Interacting mature miRNAs:	648
Transcripts:	ENST00000273990, ENST00000502763, ENST00000513992
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597504822	GWAS1600896_H	chronic obstructive pulmonary disease QTL GWAS1600896 (human)		7e-09	lung integrity trait (VT:0010906)		4	100187718	100187719	Human
597384373	GWAS1480447_H	FEV/FVC ratio QTL GWAS1480447 (human)		2e-10	FEV/FVC ratio	forced expiratory volume to forced vital capacity ratio (CMO:0000241)	4	100188431	100188432	Human

SHGC-50253

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	101,108,171 - 101,108,269	UniSTS	GRCh37
Build 36	4	101,327,194 - 101,327,292	RGD	NCBI36
Celera	4	98,406,196 - 98,406,294	RGD
Cytogenetic Map	4	q24	UniSTS
HuRef	4	96,846,408 - 96,846,506	UniSTS
TNG Radiation Hybrid Map	4	62026.0	UniSTS

SHGC-8633

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	101,107,765 - 101,107,913	UniSTS	GRCh37
Build 36	4	101,326,788 - 101,326,936	RGD	NCBI36
Celera	4	98,405,790 - 98,405,938	RGD
Cytogenetic Map	4	q24	UniSTS
HuRef	4	96,846,002 - 96,846,150	UniSTS
TNG Radiation Hybrid Map	4	62041.0	UniSTS

D4S2493E

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	101,108,313 - 101,108,395	UniSTS	GRCh37
Build 36	4	101,327,336 - 101,327,418	RGD	NCBI36
Celera	4	98,406,338 - 98,406,420	RGD
Cytogenetic Map	4	q24	UniSTS
HuRef	4	96,846,550 - 96,846,632	UniSTS
Stanford-G3 RH Map	4	5644.0	UniSTS
GeneMap99-G3 RH Map	4	5572.0	UniSTS

SHGC-24757

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	101,107,062 - 101,107,190	UniSTS	GRCh37
Build 36	4	101,326,085 - 101,326,213	RGD	NCBI36
Celera	4	98,405,087 - 98,405,215	RGD
Cytogenetic Map	4	q24	UniSTS
HuRef	4	96,845,299 - 96,845,427	UniSTS
TNG Radiation Hybrid Map	4	62071.0	UniSTS
GeneMap99-GB4 RH Map	4	494.64	UniSTS
Whitehead-RH Map	4	527.9	UniSTS
GeneMap99-G3 RH Map	4	5572.0	UniSTS

Ddit4l

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	4	101,108,981 - 101,109,057	UniSTS	GRCh37
Celera	4	98,407,006 - 98,407,082	UniSTS
HuRef	4	96,847,217 - 96,847,293	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2348	2787	2232	4926	1680	2266	6	584	1627	425	2240	6886	6157	40	3706	1	833	1713	1572	172	1


RefSeq Transcripts	NM_145244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK094236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK312926	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL832277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AP001961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AX379591	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC013592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DB208869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000273990 ⟹ ENSP00000354830

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	4	100,185,870 - 100,190,468 (-)	Ensembl

Ensembl Acc Id:

ENST00000502763 ⟹ ENSP00000427301

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	4	100,187,728 - 100,190,304 (-)	Ensembl

Ensembl Acc Id:

ENST00000513992 ⟹ ENSP00000427040

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	4	100,187,875 - 100,190,782 (-)	Ensembl

RefSeq Acc Id:

NM_145244 ⟹ NP_660287

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	100,185,870 - 100,190,468 (-)	NCBI
GRCh37	4	101,106,267 - 101,111,939 (-)	NCBI
Build 36	4	101,326,050 - 101,330,636 (-)	NCBI Archive
Celera	4	98,405,052 - 98,409,638 (-)	RGD
HuRef	4	96,845,264 - 96,850,266 (-)	ENTREZGENE
CHM1_1	4	101,083,602 - 101,088,230 (-)	NCBI
T2T-CHM13v2.0	4	103,501,503 - 103,506,101 (-)	NCBI

Sequence:

show sequence

GCTACTGCGAGGAGCCGGCGCAGGGTGGCCCGGGAGGGGTGAGCAGGGTGCCGCTGGCTGCTGGGGTCTGCAGGTCACCGAGTCCCCAGGAGAGGGGACTCCTAAGAAGCCACCTGCCTGTGTTTACC
CGGCAGCGAGCGCGCAGGCCCCCGCGAACTCCTGGCAGCGCTCAGGAAAGGCCGTTGCGCCTCGCGAAGGAAACAGAGCCGTTGACCATGGTTGCAACTGGCAGTTTGAGCAGCAAGAACCCGGCCAG
CATTTCAGAATTGCTGGACTGTGGCTATCACCCAGAGAGCCTGCTAAGTGATTTTGACTACTGGGATTATGTTGTTCCTGAACCCAACCTCAACGAGGTAATATTTGAGGAATCAACTTGCCAGAATT
TGGTTAAAATGCTGGAGAACTGTCTGTCCAAATCAAAGCAAACTAAACTTGGTTGCTCAAAGGTCCTTGTCCCTGAGAAACTGACCCAGAGAATTGCTCAAGATGTCCTGCGGCTTTCCTCAACGGAG
CCCTGCGGCTTGCGAGGTTGTGTTATGCACGTGAACTTGGAAATTGAAAATGTATGTAAAAAGCTGGATAGGATTGTGTGTGATTCTAGCGTCGTACCTACTTTTGAGCTTACACTTGTGTTTAAGCA
GGAGAACTGCTCATGGACTAGCTTCAGGGACTTTTTCTTTAGTAGAGGTCGCTTCTCCTCTGGTTTCAGGAGAACTCTGATCCTCAGCTCAGGATTTCGACTTGTTAAGAAAAAACTTTACTCACTGA
TTGGAACAACAGTGATTGAAGGGTCCTAAAAAGGGAAAATATATAAAGATTATTTCATGATTGGGTAGTAAAACTATTCAGCTAGTCAGCTAAAGTCATTTGTAGTTTGCCCCACCTGCCCTAAATAA
GAAACCCCAAATGTAGTCTCTTTTCTTTCTGTGTTTCACATTCATAGCAACTGCAGCTAACAGGCTGATTTTCTGGCCTTTGGAGAAGTGATTCAAAATAGTGTAGATTTTCTGCATAGATCCCATTT
TTGTACAGAATTGAATGGGATGGAATAGGTAAGCAAAAGTAGAAGCCCATTTGAGTTTTACATTTGATTCCACAATTTGGTTTCAGGTAGGCTTGGTAATAGACTATATAAACCAGATTTGCCTATTT
TGATTTTCATATGGCTTTTTTTTCTGTAAGTTTTCAGAGGATTTTTTAAATCACAGAATCATACTAAATGATATTTAGCCTATCAAAACTTCCAAAAGCCCACACCACCAGTTCCTGACTCAAATTTG
AAGGGTTTTTAGACAGGAGGGTAGGATTAAGTAGGTGAGTTTAATTAAAGCTTAACCCTAGGTAAGAGTAAATGAGAAATATTACGGCAATAATGGAACTGCTTCACTGTTTCTTGGTGACTTCCTCA
CTCTAATGTTTTAAAGAGGCAACAAAAGCTTGTGGTGCCATTTCAGTAACCACGGTGTTGTTTTAGATGCCTTTATAAGCTCAGTTTCCCCTGTTCTTAAGTGTTGAATACTGTCTTTAAACTAGAAA
AATGCAAAATATTGAACTGATATTTTTGTGTGTAGTTGATTACTCTTCCATTGAGTGAATGATGAATACCTGTGAGGATAGGAAATTAGTTCTGAGATCTAGTCCCTCTCTGATTCACTTAGTAATCT
ATCCTCTTTTCAGTATTACATGTGCTTAATCTCAGATGAACCATTTCACCATGGCAGTGTTATCTCATCTCTGGGCTTTTCTGGGAATTGAAGTATCTCTCCTTAACCCCAATTGTCAAGGGTAGTAG
CTGTATACTACCACTTTGAATTATTGAAACGGGTCAATTTACGAAGTCTGCATTGGCTATGGAGATATGGTTTATAGTACAGCCTAGAGAATGAAACTCACCGTCCAGATAACCATGCATGCACCCAG
ATTTTTTCCACCTTGGATACCTGTCACTAGGGAATAATAAAGGCCTGATTTTTTGTCTTATTCCAACTAAGTAGATCATTATCTCTTTCCTTTTTTATGTTAATGAGAGAATTTAGCCTCCACTCAAC
AATGTTCAATTCAGCAAGGCTTTCATATCCTTGCTGTGGGTCGTGGATAAGGAGCTTATTCAGGTTTCCTGCCCTAGCTATTAGCTCCACTTCACATGCTGGAGACCGGCGTAGGGACAGATGTATTC
ATCCTGGTGTTACTGAAAAACAGGTGTGATCCTGTTACTGATACTATAAGTGACCTAAAATGTCACTGTTCAAATTAGCCAGTGTTCTAACAAACTAAACTCTTCAAATGCTTGGAAAGATACTACAA
AGCCAATCTTTATAGAATTGGGCCAAGATAAATCTATGTTGTTTTGCATGGCTATTGTTAAGCTCCAAAGGTTCACTGTGTTTCTGCCGCTGTCCTGGAGTTGTCACCACTGACTGGGCAAGGCTTCT
TGGGCATGGATGTAGAACTGTTGTCCTTTTCCCACTAACAGTTATCTTTGACTCTCTTGCCTGTTATGCTTACAAAATGGTGATGGCTTATGGAAGGCTGTTAAATTAATATTCCTGTTAAAGGAAAT
TAAAGTTTGTCTATTTTTGACAATAAAACATTATATATTTTTAA

hide sequence


Protein RefSeqs	NP_660287	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH13592	(Get FASTA)	NCBI Sequence Viewer
	BAC04315	(Get FASTA)	NCBI Sequence Viewer
	BAG35770	(Get FASTA)	NCBI Sequence Viewer
	CAD28403	(Get FASTA)	NCBI Sequence Viewer
	CAI46176	(Get FASTA)	NCBI Sequence Viewer
	EAX06119	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000354830
	ENSP00000354830.2
GenBank Protein	Q96D03	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_660287 ⟸ NM_145244
- UniProtKB:	B2R7C3 (UniProtKB/Swiss-Prot), Q96D03 (UniProtKB/Swiss-Prot), D6RJ99 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDS SVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS hide sequence

Ensembl Acc Id:

ENSP00000427301 ⟸ ENST00000502763

Ensembl Acc Id:

ENSP00000354830 ⟸ ENST00000273990

Ensembl Acc Id:

ENSP00000427040 ⟸ ENST00000513992

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q96D03-F1-model_v2	AlphaFold	Q96D03	1-193	view protein structure

RGD ID:

6868130

Promoter ID:

EPDNEW_H7230

Type:

initiation region

Name:

DDIT4L_1

Description:

DNA damage inducible transcript 4 like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	4	100,190,468 - 100,190,528	EPDNEW

Database	Acc Id	Source(s)
COSMIC	DDIT4L	COSMIC
Ensembl Genes	ENSG00000145358	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000273990	ENTREZGENE
	ENST00000273990.6	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.470.40	UniProtKB/Swiss-Prot
GTEx	ENSG00000145358	GTEx
HGNC ID	HGNC:30555	ENTREZGENE
Human Proteome Map	DDIT4L	Human Proteome Map
InterPro	RTP801-like	UniProtKB/Swiss-Prot
	RTP801-like_C_sf	UniProtKB/Swiss-Prot
KEGG Report	hsa:115265	UniProtKB/Swiss-Prot
NCBI Gene	115265	ENTREZGENE
OMIM	607730	OMIM
PANTHER	DNA DAMAGE-INDUCIBLE TRANSCRIPT 4-LIKE PROTEIN	UniProtKB/Swiss-Prot
	PTHR12478	UniProtKB/Swiss-Prot
Pfam	RTP801_C	UniProtKB/Swiss-Prot
PharmGKB	PA128394749	PharmGKB
UniProt	B2R7C3	ENTREZGENE
	D6RD49_HUMAN	UniProtKB/TrEMBL
	D6RJ99	ENTREZGENE, UniProtKB/TrEMBL
	DDT4L_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	B2R7C3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-24	DDIT4L	DNA damage inducible transcript 4 like		DNA-damage-inducible transcript 4-like	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - CTD