Symbol:
P2ry14
Name:
purinergic receptor P2Y, G-protein coupled, 14
RGD ID:
1332276
MGI Page
MGI
Description:
Predicted to enable G protein-coupled purinergic nucleotide receptor activity. Acts upstream of or within hematopoietic stem cell homeostasis. Predicted to be located in plasma membrane. Orthologous to human P2RY14 (purinergic receptor P2Y14).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A330108O13Rik; G protein-coupled receptor 105; G-protein coupled receptor 105; Gpr1; Gpr105; P2Y purinoceptor 14; P2Y1; P2Y14; UDP-glucose receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
P2RY14 (purinergic receptor P2Y14) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
P2ry14 (purinergic receptor P2Y14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
P2ry14 (purinergic receptor P2Y14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
P2RY14 (purinergic receptor P2Y14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
P2RY14 (purinergic receptor P2Y14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
P2ry14 (purinergic receptor P2Y14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
P2RY14 (purinergic receptor P2Y14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
P2RY14 (purinergic receptor P2Y14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
P2ry14 (purinergic receptor P2Y14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
P2ry14 (purinergic receptor P2Y14)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
P2RY14 (purinergic receptor P2Y14)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
p2ry14
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 59,022,044 - 59,060,913 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 59,021,276 - 59,061,039 (-) Ensembl GRCm39 Ensembl GRCm38 3 59,114,623 - 59,153,492 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 59,113,855 - 59,153,618 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 58,918,547 - 58,934,546 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 59,202,554 - 59,218,553 (-) NCBI MGSCv36 mm8 Celera 3 58,801,934 - 58,817,836 (-) NCBI Celera Cytogenetic Map 3 D NCBI cM Map 3 28.96 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
P2ry14 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of P2RY14 mRNA CTD PMID:36331819 P2ry14 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of P2RY14 mRNA CTD PMID:22206623 P2ry14 Mouse 17beta-estradiol multiple interactions ISO P2RY14 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of P2RY14 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of P2RY14 mRNA CTD PMID:17404688 and PMID:20660070 P2ry14 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of P2RY14 mRNA CTD PMID:39298647 P2ry14 Mouse 17beta-estradiol multiple interactions ISO P2ry14 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of P2RY14 mRNA CTD PMID:26496021 P2ry14 Mouse 17beta-estradiol multiple interactions EXP 6480464 bazedoxifene inhibits the reaction [Estradiol results in increased expression of P2RY14 mRNA] more ... CTD PMID:18367319 P2ry14 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of P2RY14 mRNA CTD PMID:18367319 P2ry14 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of P2RY14 mRNA CTD PMID:21570461 P2ry14 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 P2ry14 Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of P2RY14 mRNA CTD PMID:25172293 P2ry14 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of P2RY14 mRNA CTD PMID:30951980 P2ry14 Mouse 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of P2RY14 exon and bisphenol S results in decreased methylation of P2RY14 promoter CTD PMID:33297965 P2ry14 Mouse 6-propyl-2-thiouracil decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of P2RY14 mRNA CTD PMID:24780913 P2ry14 Mouse acetamide increases expression ISO P2ry14 (Rattus norvegicus) 6480464 acetamide results in increased expression of P2RY14 mRNA CTD PMID:31881176 P2ry14 Mouse aflatoxin B1 increases methylation ISO P2RY14 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of P2RY14 gene CTD PMID:27153756 P2ry14 Mouse all-trans-retinoic acid increases expression ISO P2RY14 (Homo sapiens) 6480464 Tretinoin results in increased expression of P2RY14 mRNA CTD PMID:15498508 and PMID:33167477 P2ry14 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of P2RY14 mRNA CTD PMID:36189433 P2ry14 Mouse all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of P2RY14 mRNA CTD PMID:36189433 P2ry14 Mouse ammonium chloride affects expression ISO P2ry14 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of P2RY14 mRNA CTD PMID:16483693 P2ry14 Mouse bazedoxifene multiple interactions EXP 6480464 bazedoxifene inhibits the reaction [Estradiol results in increased expression of P2RY14 mRNA] CTD PMID:18367319 P2ry14 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of P2RY14 mRNA CTD PMID:19770486 P2ry14 Mouse biochanin A decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 biochanin A results in decreased expression of P2RY14 mRNA CTD PMID:34848279 P2ry14 Mouse biochanin A multiple interactions ISO P2ry14 (Rattus norvegicus) 6480464 Fulvestrant inhibits the reaction [biochanin A results in decreased expression of P2RY14 mRNA] CTD PMID:34848279 P2ry14 Mouse bisphenol A multiple interactions ISO P2ry14 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of P2RY14 mRNA CTD PMID:26496021 P2ry14 Mouse bisphenol A increases expression ISO P2ry14 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of P2RY14 mRNA CTD PMID:30816183 and PMID:32528016 P2ry14 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of P2RY14 mRNA CTD PMID:30951980 P2ry14 Mouse bisphenol A decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of P2RY14 mRNA CTD PMID:25181051 P2ry14 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of P2RY14 mRNA CTD PMID:30951980 P2ry14 Mouse cadmium atom multiple interactions ISO P2RY14 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of P2RY14 mRNA CTD PMID:35301059 P2ry14 Mouse cadmium dichloride multiple interactions ISO P2RY14 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of P2RY14 mRNA CTD PMID:35301059 P2ry14 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon analog results in increased expression of P2RY14 mRNA CTD PMID:25554681 P2ry14 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of P2RY14 mRNA CTD PMID:20938992 P2ry14 Mouse Dibutyl phosphate affects expression ISO P2RY14 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of P2RY14 mRNA CTD PMID:37042841 P2ry14 Mouse dibutyl phthalate decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of P2RY14 mRNA CTD PMID:21266533 P2ry14 Mouse diuron decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 Diuron results in decreased expression of P2RY14 mRNA CTD PMID:25152437 P2ry14 Mouse doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of P2RY14 mRNA CTD PMID:28608983 P2ry14 Mouse ethanol multiple interactions EXP 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of P2RY14 mRNA CTD PMID:30517762 P2ry14 Mouse flutamide decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of P2RY14 mRNA CTD PMID:24136188 P2ry14 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of P2RY14 mRNA CTD PMID:20938992 P2ry14 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of P2RY14 mRNA CTD PMID:25629700 P2ry14 Mouse fulvestrant multiple interactions ISO P2ry14 (Rattus norvegicus) 6480464 Fulvestrant inhibits the reaction [biochanin A results in decreased expression of P2RY14 mRNA] CTD PMID:34848279 P2ry14 Mouse glafenine decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 Glafenine results in decreased expression of P2RY14 mRNA CTD PMID:24136188 P2ry14 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of P2RY14 mRNA CTD PMID:36331819 P2ry14 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of P2RY14 mRNA CTD PMID:20938992 P2ry14 Mouse lasofoxifene multiple interactions EXP 6480464 Lasofoxifene inhibits the reaction [Estradiol results in increased expression of P2RY14 mRNA] CTD PMID:18367319 P2ry14 Mouse lipopolysaccharide decreases expression ISO P2RY14 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of P2RY14 mRNA CTD PMID:35811015 P2ry14 Mouse lipopolysaccharide multiple interactions ISO P2RY14 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 P2ry14 Mouse mifepristone increases expression ISO P2RY14 (Homo sapiens) 6480464 Mifepristone results in increased expression of P2RY14 mRNA CTD PMID:17584828 P2ry14 Mouse mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of P2RY14 mRNA CTD PMID:36189433 P2ry14 Mouse oxaliplatin multiple interactions ISO P2ry14 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of P2RY14 mRNA CTD PMID:25729387 P2ry14 Mouse ozone multiple interactions ISO P2RY14 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of P2RY14 mRNA CTD PMID:35430440 P2ry14 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of P2RY14 mRNA more ... CTD PMID:36331819 P2ry14 Mouse perfluorooctanoic acid decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in decreased expression of P2RY14 mRNA CTD PMID:19162173 P2ry14 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of P2RY14 mRNA CTD PMID:23091169 P2ry14 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of P2RY14 mRNA and [pirinixic acid co-treated with PPARA] results in increased expression of P2RY14 mRNA CTD PMID:19710929 and PMID:20813756 P2ry14 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of P2RY14 mRNA CTD PMID:18301758 more ... P2ry14 Mouse progesterone multiple interactions ISO P2RY14 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of P2RY14 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of P2RY14 mRNA CTD PMID:17404688 and PMID:20660070 P2ry14 Mouse progesterone multiple interactions EXP 6480464 Progesterone inhibits the reaction [Estradiol results in increased expression of P2RY14 mRNA] CTD PMID:18367319 P2ry14 Mouse progesterone increases expression ISO P2RY14 (Homo sapiens) 6480464 Progesterone results in increased expression of P2RY14 mRNA CTD PMID:17404688 and PMID:20864642 P2ry14 Mouse raloxifene multiple interactions EXP 6480464 Raloxifene Hydrochloride inhibits the reaction [Estradiol results in increased expression of P2RY14 mRNA] CTD PMID:18367319 P2ry14 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO P2RY14 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 P2ry14 Mouse silver atom increases expression EXP 6480464 Silver results in increased expression of P2RY14 mRNA CTD PMID:27131904 P2ry14 Mouse silver(0) increases expression EXP 6480464 Silver results in increased expression of P2RY14 mRNA CTD PMID:27131904 P2ry14 Mouse Soman decreases expression ISO P2ry14 (Rattus norvegicus) 6480464 Soman results in decreased expression of P2RY14 mRNA CTD PMID:19281266 P2ry14 Mouse tamibarotene increases expression ISO P2RY14 (Homo sapiens) 6480464 tamibarotene results in increased expression of P2RY14 mRNA CTD PMID:15498508 P2ry14 Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of P2RY14 mRNA CTD PMID:17484886 P2ry14 Mouse tetrachloromethane multiple interactions EXP 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of P2RY14 mRNA CTD PMID:30517762 P2ry14 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of P2RY14 mRNA CTD PMID:27339419 P2ry14 Mouse toluene increases expression ISO P2ry14 (Rattus norvegicus) 6480464 Toluene results in increased expression of P2RY14 mRNA CTD PMID:22967744 P2ry14 Mouse topotecan multiple interactions ISO P2ry14 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of P2RY14 mRNA CTD PMID:25729387 P2ry14 Mouse triphenyl phosphate affects expression ISO P2RY14 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of P2RY14 mRNA CTD PMID:37042841 P2ry14 Mouse valproic acid decreases methylation ISO P2RY14 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of P2RY14 gene CTD PMID:29154799 P2ry14 Mouse vinclozolin increases expression ISO P2ry14 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of P2RY14 mRNA CTD PMID:22570695
(1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) ammonium chloride (ISO) bazedoxifene (EXP) benzo[a]pyrene (EXP) biochanin A (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) choline (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diuron (ISO) doxorubicin (EXP) ethanol (EXP) flutamide (ISO) folic acid (EXP) fulvestrant (ISO) glafenine (ISO) inulin (EXP) L-methionine (EXP) lasofoxifene (EXP) lipopolysaccharide (ISO) mifepristone (ISO) mono(2-ethylhexyl) phthalate (EXP) oxaliplatin (ISO) ozone (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (ISO) phenobarbital (EXP) pirinixic acid (EXP) progesterone (EXP,ISO) raloxifene (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silver atom (EXP) silver(0) (EXP) Soman (ISO) tamibarotene (ISO) tetrachloromethane (EXP) toluene (ISO) topotecan (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (ISO)
P2ry14 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 59,022,044 - 59,060,913 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 59,021,276 - 59,061,039 (-) Ensembl GRCm39 Ensembl GRCm38 3 59,114,623 - 59,153,492 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 59,113,855 - 59,153,618 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 58,918,547 - 58,934,546 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 59,202,554 - 59,218,553 (-) NCBI MGSCv36 mm8 Celera 3 58,801,934 - 58,817,836 (-) NCBI Celera Cytogenetic Map 3 D NCBI cM Map 3 28.96 NCBI
P2RY14 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 151,212,117 - 151,278,542 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 151,212,117 - 151,278,542 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 150,929,905 - 150,996,330 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 152,412,595 - 152,478,920 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 152,412,604 - 152,478,852 NCBI Celera 3 149,342,683 - 149,409,005 (-) NCBI Celera Cytogenetic Map 3 q25.1 NCBI HuRef 3 148,302,942 - 148,369,134 (-) NCBI HuRef CHM1_1 3 150,893,105 - 150,959,426 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 153,963,174 - 154,029,607 (-) NCBI T2T-CHM13v2.0
P2ry14 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 145,522,598 - 145,563,074 (-) NCBI GRCr8 mRatBN7.2 2 143,372,697 - 143,413,213 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 143,372,697 - 143,413,141 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 150,013,571 - 150,029,564 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 148,125,045 - 148,140,995 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 142,757,465 - 142,773,415 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 149,331,948 - 149,379,336 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 149,331,948 - 149,347,796 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 168,749,682 - 168,791,344 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 148,501,968 - 148,503,616 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 148,451,930 - 148,453,579 (-) NCBI Celera 2 137,798,540 - 137,800,188 (-) NCBI Celera Cytogenetic Map 2 q26 NCBI
P2ry14 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955448 2,350,846 - 2,367,633 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955448 2,350,846 - 2,367,633 (-) NCBI ChiLan1.0 ChiLan1.0
P2RY14 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 149,111,794 - 149,177,346 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 149,116,527 - 149,182,005 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 148,240,705 - 148,306,186 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 155,810,973 - 155,876,246 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 155,812,156 - 155,813,172 (-) Ensembl panpan1.1 panPan2
P2RY14 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 45,803,507 - 45,821,981 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 45,798,344 - 45,799,366 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 45,798,344 - 45,799,366 (-) NCBI CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 45,662,190 - 45,713,761 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 46,424,518 - 46,476,154 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 46,425,607 - 46,426,629 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 46,013,431 - 46,065,011 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 46,065,643 - 46,117,226 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 46,342,696 - 46,394,382 (-) NCBI UU_Cfam_GSD_1.0
P2ry14 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 90,240,000 - 90,281,060 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936758 1,494,234 - 1,527,789 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936758 1,494,253 - 1,509,217 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
P2RY14 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 91,396,675 - 91,453,699 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 91,396,006 - 91,453,761 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 99,454,991 - 99,459,639 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
P2RY14 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 39,419,181 - 39,481,252 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 39,480,167 - 39,481,183 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 12,238,163 - 12,299,403 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
P2ry14
.
Predicted Target Of
Count of predictions: 186 Count of miRNA genes: 89 Interacting mature miRNAs: 91 Transcripts: ENSMUST00000065220, ENSMUST00000091112 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 14746977 Manh53_m mandible shape 53 (mouse) 3 35925280 69925280 Mouse 26884378 Skwq6_m skull length QTL 6, 10 week (mouse) 3 51907421 102307316 Mouse 15039332 Nmrs6_m NAFLD-associated magnetic resonance shift 6 (mouse) 3 34170741 68170741 Mouse 1301585 Cd4ts1_m CD4 T cell subset 1 (mouse) Not determined 3 39704102 73704231 Mouse 4141116 Lgaq4_m late growth adjusted QTL 4 (mouse) Not determined 10249221 83184946 Mouse 4141563 Lgq3_m late growth QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1357584 Splq6_m spleen weight QTL 6 (mouse) Not determined 3 10249221 83184946 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041901 Lmr11b_m leishmaniasis resistance 11b (mouse) 3 39704102 73704231 Mouse 1357585 Manln3_m mandible length 3 (mouse) Not determined 3 52625509 86625745 Mouse 26884380 Skwq1_m skull length QTL 1, 5 week (mouse) 3 43954435 101607316 Mouse 13464139 Nhdlq17_m non-HDL QTL 17 (mouse) 3 52923183 86923183 Mouse 1300895 Hdl5_m HDL level 5 (mouse) Not determined 3 49495005 83495118 Mouse 15039336 Nmrs2_m NAFLD-associated magnetic resonance shift 2 (mouse) 3 34576103 68576103 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 1301917 Tshp4_m tooth shape 4 (mouse) Not determined 3 52625509 86625745 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 1301824 Susp_m suppressor of superoxide production (mouse) Not determined 3 49495005 83495118 Mouse 1357440 Hrtpq1_m heart weight percentage QTL 1 (mouse) Not determined 3 10249221 83184946 Mouse 10755516 Amzn1_m anatomical modifier of Zfp423 1 (mouse) 3 39704102 73704231 Mouse 1558925 Hivan1_m HIV-associated nephropathy 1 (mouse) Not determined 3 7586174 68716946 Mouse 9587784 Afw13_m abdominal fat weight QTL 13 (mouse) Not determined 3 33752045 67752228 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 39128206 Lwq18_m liver weight QTL 18 (mouse) 3 10249221 83184946 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 1300593 Skull4_m skull morphology 4 (mouse) Not determined 3 52625509 86625745 Mouse 12880419 V125Dq4_m vitamin D active form serum level QTL 4 (mouse) 3 58907307 92907307 Mouse 4141079 Ath23_m atherosclerosis 23 (mouse) Not determined 49357581 83357581 Mouse 18337272 Bmd46_m bone mineral density 46, males (mouse) 3 35407421 69407421 Mouse 11039513 Ltpr3a_m Leishmania tropica response 3a (mouse) 3 39704102 73704231 Mouse 1300961 Bh4p_m bar holding four paws (mouse) Not determined 3 31837854 65837997 Mouse 10043882 Bwtq13_m body weight QTL 13 (mouse) Not determined 3 33752045 67752228 Mouse 10412073 Ssen2_m suseptibility to Sendai virus 2 (mouse) Not determined 3 33535465 67535615 Mouse 11039519 Ltpr3_m Leishmania tropica response 3 (mouse) 3 56704102 100464137 Mouse 4141255 W10q3_m weight 10 weeks QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1300587 Aod2_m autoimmune ovarian dysgenesis 2 (mouse) Not determined 3 37179742 68716946 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 13208566 Bmiq5_m body mass index QTL 5 (mouse) 3 40954435 115793649 Mouse 26884389 Skwq10_m skull length QTL 10, 16 week (mouse) 3 43954435 65307421 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000065220 ⟹ ENSMUSP00000066669
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,114,625 - 59,130,624 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000091112 ⟹ ENSMUSP00000088642
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,114,626 - 59,130,622 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000196081 ⟹ ENSMUSP00000142601
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,114,625 - 59,153,492 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000196716
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,145,824 - 59,153,618 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000197220 ⟹ ENSMUSP00000143070
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,114,932 - 59,131,327 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000197841 ⟹ ENSMUSP00000142934
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,113,855 - 59,130,762 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000198838 ⟹ ENSMUSP00000143499
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,116,011 - 59,131,118 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000200358 ⟹ ENSMUSP00000142641
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,115,707 - 59,131,213 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000200673 ⟹ ENSMUSP00000142718
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm38.p6 Ensembl 3 59,116,026 - 59,132,462 (-) Ensembl
RefSeq Acc Id:
NM_001008497 ⟹ NP_001008497
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 59,022,044 - 59,038,183 (-) NCBI GRCm38 3 59,114,623 - 59,130,762 (-) NCBI MGSCv37 3 58,918,547 - 58,934,546 (-) RGD Celera 3 58,801,932 - 58,840,702 (-) NCBI cM Map 3 ENTREZGENE
Sequence:
GCAGAATAGCAGTGTGCAGTAGCAGAGATGGGGTTAAAAGGAGTTATCTGATCCTGTGAAGGGGACAAGTGCAGCTGGGTTATGACGCAACCCTCGGAGCAAAGGCAGCTCAATAACTAAAATGCTTA
hide sequence
RefSeq Acc Id:
NM_001287119 ⟹ NP_001274048
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 59,022,044 - 59,060,913 (-) NCBI GRCm38 3 59,114,623 - 59,153,492 (-) NCBI Celera 3 58,801,932 - 58,840,702 (-) NCBI
Sequence:
GTCCTCTGGAACCTACACTGAGACATATTCCAACATGAGTGTAGTCTGACGTGCACTACAGGAG
hide sequence
RefSeq Acc Id:
NM_001287120 ⟹ NP_001274049
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 59,022,044 - 59,039,883 (-) NCBI GRCm38 3 59,114,623 - 59,132,462 (-) NCBI Celera 3 58,801,932 - 58,840,702 (-) NCBI
Sequence:
TAACTCCATCCACAAGTACAAAGACACAAGGACTACAAGCTCTGAGGCTGCTGAGCTCCTACAG
hide sequence
RefSeq Acc Id:
NM_001287121 ⟹ NP_001274050
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 59,022,044 - 59,038,749 (-) NCBI GRCm38 3 59,114,623 - 59,131,328 (-) NCBI Celera 3 58,801,932 - 58,840,702 (-) NCBI
Sequence:
GCTGTTTACCCTTGATCAGGCCTTGACAATCTGTAACCCTTAGCAAATCTACATCAGCTCCAAC
hide sequence
RefSeq Acc Id:
NM_001287122 ⟹ NP_001274051
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 59,022,044 - 59,038,539 (-) NCBI GRCm38 3 59,114,623 - 59,131,118 (-) NCBI Celera 3 58,801,932 - 58,840,702 (-) NCBI
Sequence:
AACATGAACAGCCCAAGCTAAAAAGCAAAGTACATTTCCCTCAGTACCAGTCAGATGTTATACT
hide sequence
RefSeq Acc Id:
NM_001287123 ⟹ NP_001274052
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 59,022,044 - 59,038,749 (-) NCBI GRCm38 3 59,114,623 - 59,131,328 (-) NCBI Celera 3 58,801,932 - 58,840,702 (-) NCBI
Sequence:
GCTGTTTACCCTTGATCAGGCCTTGACAATCTGTAACCCTTAGCAAATCTACATCAGCTCCAACTTATATAAGCACAAACTAGAGCCGGCCTCCAAAAGCTGGTGGAAATCTGTACTGCTGGATGCTC
hide sequence
RefSeq Acc Id:
NM_001287124 ⟹ NP_001274053
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 59,022,044 - 59,038,183 (-) NCBI GRCm38 3 59,114,623 - 59,130,762 (-) NCBI Celera 3 58,801,932 - 58,840,702 (-) NCBI
Sequence:
GCAGAATAGCAGTGTGCAGTAGCAGAGATGGGGTTAAAAGGAGTTATCTGATCCTGTGAAGGGGACAAGTGCAGCTGGGTTATGACGCAACCCTCGGAGCAAAGGCAGCTCAATAACTAAAATGCTTA
hide sequence
RefSeq Acc Id:
NM_133200 ⟹ NP_573463
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 59,022,044 - 59,038,183 (-) NCBI GRCm38 3 59,114,623 - 59,130,762 (-) NCBI MGSCv37 3 58,918,547 - 58,934,546 (-) RGD Celera 3 58,801,932 - 58,840,702 (-) NCBI cM Map 3 ENTREZGENE
Sequence:
GCAGAATAGCAGTGTGCAGTAGCAGAGATGGGGTTAAAAGGAGTTATCTGATCCTGTGAAGGGG
hide sequence
RefSeq Acc Id:
NP_573463 ⟸ NM_133200
- Peptide Label:
isoform a
- UniProtKB:
Q9ESG6 (UniProtKB/Swiss-Prot), Q544F4 (UniProtKB/TrEMBL)
- Sequence:
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLL
hide sequence
RefSeq Acc Id:
NP_001008497 ⟸ NM_001008497
- Peptide Label:
isoform a
- UniProtKB:
Q9ESG6 (UniProtKB/Swiss-Prot), Q544F4 (UniProtKB/TrEMBL)
- Sequence:
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLL
hide sequence
RefSeq Acc Id:
NP_001274048 ⟸ NM_001287119
- Peptide Label:
isoform a
- UniProtKB:
Q9ESG6 (UniProtKB/Swiss-Prot), Q544F4 (UniProtKB/TrEMBL)
- Sequence:
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLL
hide sequence
RefSeq Acc Id:
NP_001274049 ⟸ NM_001287120
- Peptide Label:
isoform a
- UniProtKB:
Q9ESG6 (UniProtKB/Swiss-Prot), Q544F4 (UniProtKB/TrEMBL)
- Sequence:
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLL
hide sequence
RefSeq Acc Id:
NP_001274050 ⟸ NM_001287121
- Peptide Label:
isoform a
- UniProtKB:
Q9ESG6 (UniProtKB/Swiss-Prot), Q544F4 (UniProtKB/TrEMBL)
- Sequence:
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLL
hide sequence
RefSeq Acc Id:
NP_001274052 ⟸ NM_001287123
- Peptide Label:
isoform a
- UniProtKB:
Q9ESG6 (UniProtKB/Swiss-Prot), Q544F4 (UniProtKB/TrEMBL)
- Sequence:
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLL
hide sequence
RefSeq Acc Id:
NP_001274051 ⟸ NM_001287122
- Peptide Label:
isoform a
- UniProtKB:
Q9ESG6 (UniProtKB/Swiss-Prot), Q544F4 (UniProtKB/TrEMBL)
- Sequence:
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRYYKIVKPLL
hide sequence
RefSeq Acc Id:
NP_001274053 ⟸ NM_001287124
- Peptide Label:
isoform b
- UniProtKB:
A0A0G2JEW9 (UniProtKB/TrEMBL)
- Sequence:
MIFASRGEKMNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDR
hide sequence
Ensembl Acc Id:
ENSMUSP00000143499 ⟸ ENSMUST00000198838
Ensembl Acc Id:
ENSMUSP00000088642 ⟸ ENSMUST00000091112
Ensembl Acc Id:
ENSMUSP00000143070 ⟸ ENSMUST00000197220
Ensembl Acc Id:
ENSMUSP00000066669 ⟸ ENSMUST00000065220
Ensembl Acc Id:
ENSMUSP00000142934 ⟸ ENSMUST00000197841
Ensembl Acc Id:
ENSMUSP00000142601 ⟸ ENSMUST00000196081
Ensembl Acc Id:
ENSMUSP00000142718 ⟸ ENSMUST00000200673
Ensembl Acc Id:
ENSMUSP00000142641 ⟸ ENSMUST00000200358
RGD ID: 6834187 Promoter ID: MM_KWN:34421 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Kidney Transcripts: NM_001008497, NM_133200, UC008PIM.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 58,934,421 - 58,936,237 (-) MPROMDB
RGD ID: 6880732 Promoter ID: EPDNEW_M3817 Type: initiation region Name: P2ry14_3 Description: Mus musculus purinergic receptor P2Y, G-protein coupled, 14 ,transcript variant 3, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M3818 EPDNEW_M3819 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 59,130,619 - 59,130,679 EPDNEW
RGD ID: 6880734 Promoter ID: EPDNEW_M3818 Type: multiple initiation site Name: P2ry14_2 Description: Mus musculus purinergic receptor P2Y, G-protein coupled, 14 ,transcript variant 3, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M3817 EPDNEW_M3819 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 59,131,073 - 59,131,133 EPDNEW
RGD ID: 6880736 Promoter ID: EPDNEW_M3819 Type: initiation region Name: P2ry14_1 Description: Mus musculus purinergic receptor P2Y, G-protein coupled, 14 ,transcript variant 3, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M3817 EPDNEW_M3818 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 59,153,496 - 59,153,556 EPDNEW
