Symbol:
Tsacc
Name:
TSSK6 activating co-chaperone
RGD ID:
1331902
MGI Page
MGI
Description:
Predicted to enable Hsp70 protein binding activity; protein kinase binding activity; and protein kinase inhibitor activity. Predicted to act upstream of or within positive regulation of protein kinase activity. Located in cytoplasm. Orthologous to human TSACC (TSSK6 activating cochaperone).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1700021C14Rik; MGC130252; SIP; SSTK-interacting protein; TSSK6-activating co-chaperone protein; uncharacterized protein C1orf182 homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TSACC (TSSK6 activating cochaperone) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Tsacc (TSSK6 activating co-chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TSACC (TSSK6 activating cochaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tsacc (TSSK6 activating cochaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TSACC (TSSK6 activating cochaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TSACC (TSSK6 activating cochaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tsacc (TSSK6 activating co-chaperone)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TSACC (TSSK6 activating cochaperone)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 88,190,059 - 88,204,306 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 88,190,064 - 88,204,306 (-) Ensembl GRCm39 Ensembl GRCm38 3 88,282,752 - 88,296,999 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 88,282,757 - 88,296,999 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 88,086,682 - 88,100,760 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 88,368,677 - 88,382,870 (-) NCBI MGSCv36 mm8 Celera 3 88,322,340 - 88,336,408 (-) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 38.79 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tsacc Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of TSACC mRNA CTD PMID:22206623 Tsacc Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1604756 6480464 Tetrachlorodibenzodioxin results in decreased expression of TSACC mRNA CTD PMID:27913140 Tsacc Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1304953 6480464 Tetrachlorodibenzodioxin results in increased expression of TSACC mRNA CTD PMID:33387578 Tsacc Mouse acrylamide decreases expression ISO RGD:1304953 6480464 Acrylamide results in decreased expression of TSACC mRNA CTD PMID:28959563 Tsacc Mouse benzo[a]pyrene affects expression ISO RGD:1604756 6480464 Benzo(a)pyrene affects the expression of TSACC mRNA CTD PMID:22316170 Tsacc Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TSACC mRNA CTD PMID:32156529 Tsacc Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TSACC mRNA CTD PMID:38074096 Tsacc Mouse cadmium dichloride increases methylation ISO RGD:1304953 6480464 Cadmium Chloride results in increased methylation of TSACC promoter CTD PMID:22457795 Tsacc Mouse cadmium dichloride decreases expression ISO RGD:1604756 6480464 Cadmium Chloride results in decreased expression of TSACC mRNA CTD PMID:38382870 Tsacc Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon analog results in decreased expression of TSACC mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Tsacc Mouse cisplatin increases expression ISO RGD:1604756 6480464 Cisplatin results in increased expression of TSACC mRNA CTD PMID:27392435 Tsacc Mouse folic acid multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of TSACC mRNA CTD PMID:22206623 Tsacc Mouse gentamycin decreases expression ISO RGD:1304953 6480464 Gentamicins results in decreased expression of TSACC mRNA CTD PMID:33387578 Tsacc Mouse lipopolysaccharide multiple interactions ISO RGD:1604756 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of TSACC mRNA CTD PMID:35811015 Tsacc Mouse okadaic acid increases expression ISO RGD:1604756 6480464 Okadaic Acid results in increased expression of TSACC mRNA CTD PMID:38832940 Tsacc Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of TSACC mRNA CTD PMID:36331819 Tsacc Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1604756 6480464 [S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of TSACC mRNA CTD PMID:35811015 Tsacc Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of TSACC mRNA CTD PMID:37682722 Tsacc Mouse trichloroethene increases expression ISO RGD:1304953 6480464 Trichloroethylene results in increased expression of TSACC mRNA CTD PMID:33387578 Tsacc Mouse urethane decreases expression ISO RGD:1604756 6480464 Urethane results in decreased expression of TSACC mRNA CTD PMID:28818685 Tsacc Mouse valproic acid decreases methylation ISO RGD:1604756 6480464 Valproic Acid results in decreased methylation of TSACC gene CTD PMID:29154799
Tsacc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 88,190,059 - 88,204,306 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 88,190,064 - 88,204,306 (-) Ensembl GRCm39 Ensembl GRCm38 3 88,282,752 - 88,296,999 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 88,282,757 - 88,296,999 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 88,086,682 - 88,100,760 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 88,368,677 - 88,382,870 (-) NCBI MGSCv36 mm8 Celera 3 88,322,340 - 88,336,408 (-) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 38.79 NCBI
TSACC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 156,337,314 - 156,346,995 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 156,337,314 - 156,346,995 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 156,307,105 - 156,316,786 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 154,573,727 - 154,583,410 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 129,380,041 - 129,389,722 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI HuRef 1 127,667,393 - 127,677,074 (+) NCBI HuRef CHM1_1 1 157,703,460 - 157,713,141 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 155,475,925 - 155,485,606 (+) NCBI T2T-CHM13v2.0
Tsacc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 176,053,672 - 176,063,412 (-) NCBI GRCr8 mRatBN7.2 2 173,755,841 - 173,765,564 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 173,753,786 - 173,765,404 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 180,900,493 - 180,910,017 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 178,922,850 - 178,932,375 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 173,522,690 - 173,532,236 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 187,659,103 - 187,668,781 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 187,659,106 - 187,668,708 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 207,062,118 - 207,071,794 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 180,371,102 - 180,380,656 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 180,321,214 - 180,330,802 (-) NCBI Celera 2 167,701,813 - 167,711,196 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
TSACC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 93,499,868 - 93,508,705 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 93,231,792 - 93,240,630 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 131,679,671 - 131,709,720 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 135,509,008 - 135,516,918 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 135,509,160 - 135,516,912 (+) Ensembl panpan1.1 panPan2
Tsacc Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 26,523,970 - 26,530,686 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 5,559,663 - 5,561,051 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 5,559,624 - 5,561,051 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TSACC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 93,725,531 - 93,728,761 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 93,725,672 - 93,735,029 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 102,427,767 - 102,436,021 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TSACC
.
Predicted Target Of
Count of predictions: 319 Count of miRNA genes: 181 Interacting mature miRNAs: 188 Transcripts: ENSMUST00000010682, ENSMUST00000107556, ENSMUST00000123536 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 26884378 Skwq6_m skull length QTL 6, 10 week (mouse) 3 51907421 102307316 Mouse 1301971 Cia5_m collagen induced arthritis QTL 5 (mouse) Not determined 3 66046658 100046795 Mouse 1301392 Eae3_m susceptibility to experimental allergic encephalomyelitis 3 (mouse) Not determined 3 79548730 113548837 Mouse 1301904 Iba2_m induction of brown adipocytes 2 (mouse) Not determined 3 82147043 116147184 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041900 Lmr11a_m leishmaniasis resistance 11a (mouse) 3 83463991 117464137 Mouse 26884380 Skwq1_m skull length QTL 1, 5 week (mouse) 3 43954435 101607316 Mouse 14746984 Manh54_m mandible shape 54 (mouse) 3 85289152 119289152 Mouse 12738440 Twq3_m testis weight QTL 3 (mouse) 3 87228015 121228015 Mouse 25314313 Syncl1_m synaptonemal complex length 1 (mouse) 3 67907333 128393649 Mouse 1301272 Cfsw1_m cystic fibrosis survival to weaning 1 (mouse) Not determined 3 83882912 117883044 Mouse 1301791 Char4_m P. chabaudi malaria resistance QTL 4 (mouse) Not determined 3 69625509 100655290 Mouse 11049572 Lmr11c_m leishmaniasis resistance 11c (mouse) 3 72139967 106140094 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 4141294 Bmd24_m bone mineral density 24 (mouse) Not determined 3 61740061 95740241 Mouse 10043981 Cia5a_m collagen induced arthritis QTL 5a (mouse) Not determined 3 87170454 89140094 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1357583 Sle18_m systematic lupus erythematosus susceptibility 18 (mouse) Not determined 3 87208904 125316236 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 1300595 Tmevd2_m Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 2 (mouse) Not determined 3 75463302 109463549 Mouse 11251721 Ewc3_m ethanol withdrawal and consumption 3 (mouse) 3 69568554 103568554 Mouse 1300982 Lmr11_m leishmaniasis resistance 11 (mouse) Not determined 3 72139967 106140094 Mouse 12880419 V125Dq4_m vitamin D active form serum level QTL 4 (mouse) 3 58907307 92907307 Mouse 1301947 Pcfm3_m periosteal circumference and femur length 3 (mouse) Not determined 3 81084652 115084797 Mouse 4142099 Cq3_m cholesterol QTL 3 (mouse) Not determined 3 84888918 118889067 Mouse 11039512 Ltpr3b_m Leishmania tropica response 3b (mouse) 3 83463991 117464137 Mouse 11039519 Ltpr3_m Leishmania tropica response 3 (mouse) 3 56704102 100464137 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 11039507 Ltpr3g_m Leishmania tropica response 3g (mouse) 3 83463991 117464137 Mouse 11039508 Ltpr3f_m Leishmania tropica response 3f (mouse) 3 83463991 117464137 Mouse 1301422 Sle11_m systematic lupus erythematosus susceptibility 11 (mouse) Not determined 3 70208904 104209042 Mouse 11039509 Ltpr3e_m Leishmania tropica response 3e (mouse) 3 83463991 117464137 Mouse 11039510 Ltpr3d_m Leishmania tropica response 3d (mouse) 3 83463991 117464137 Mouse 13208566 Bmiq5_m body mass index QTL 5 (mouse) 3 40954435 115793649 Mouse 11039511 Ltpr3c_m Leishmania tropica response 3c (mouse) 3 83463991 117464137 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000010682 ⟹ ENSMUSP00000010682
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 88,190,067 - 88,204,145 (-) Ensembl GRCm38.p6 Ensembl 3 88,282,760 - 88,296,838 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000107556 ⟹ ENSMUSP00000103180
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 88,190,064 - 88,204,306 (-) Ensembl GRCm38.p6 Ensembl 3 88,282,757 - 88,296,999 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000123536
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 88,202,231 - 88,204,203 (-) Ensembl GRCm38.p6 Ensembl 3 88,294,924 - 88,296,896 (-) Ensembl
RefSeq Acc Id:
NM_001357024 ⟹ NP_001343953
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 88,190,061 - 88,204,306 (-) NCBI GRCm38 3 88,282,754 - 88,296,999 (-) NCBI
Sequence:
GATGTAGGGGACTGGGAGACGCAAGCGCTTGCGCACTGGCGTGGCCGCTCCCGGCCGCGTGCGGCCAGAATGTCTGCGCAAGCGCCAAAGCACGGGCAGTTAGCTGGCTCGCTACAGCGCATGAGTAC
hide sequence
RefSeq Acc Id:
NM_029801 ⟹ NP_084077
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 88,190,061 - 88,204,145 (-) NCBI GRCm38 3 88,282,754 - 88,296,838 (-) NCBI MGSCv37 3 88,086,682 - 88,100,760 (-) RGD Celera 3 88,322,340 - 88,336,408 (-) RGD cM Map 3 ENTREZGENE
Sequence:
GGATTAATGCTGTAGGTAAGATCATGAAGCTCTGTTTTGTCCATCGGTTCTCGTCCGACCGTGAAGGCCAAGGAAGGCACCAGACCTGTTGCTGTCAAGATGGAGCAGCACACTAGTAACCCTACTAA
hide sequence
RefSeq Acc Id:
XM_030252882 ⟹ XP_030108742
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 88,190,059 - 88,204,267 (-) NCBI GRCm38 3 88,282,752 - 88,296,911 (-) NCBI
Sequence:
CGTGGCCGCTCCCGGCCGCGTGCGGCCAGAATGTCTGCGCAAGCGCCAAAGCACGGGCAGTTAGCTGGCTCGCTACAGCGCATGAGTACCCACTAGAGGGTGGGTGCTGGGGTGGAGGCTTTGGATTA
hide sequence
RefSeq Acc Id:
XM_030252883 ⟹ XP_030108743
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 88,190,059 - 88,202,729 (-) NCBI GRCm38 3 88,282,752 - 88,295,421 (-) NCBI
Sequence:
GCAGCACACTAGTAACCCTACTAAGGAAAAAGGTGTGTCACAGCCCCTGTGTCCCCTCCCTCAGAAGCCAGCCTTCCCCATTCACTCAGGGTTTCAGAAATGAAACTAAGGAAAAAGGTGTGTCACAG
hide sequence
RefSeq Acc Id:
NP_084077 ⟸ NM_029801
- UniProtKB:
Q9DA44 (UniProtKB/Swiss-Prot)
- Sequence:
MEQHTSNPTKEKAKEEDSVACFCPAKSSPSYIDLPANFTPANFLTIQTKLSSGAGQKPKGCLGVLECMYANLQLQTQLAQRQIAILENLQASLSQPGSGRESKNCSLPGLCCKLLLNHLPQFHK
hide sequence
RefSeq Acc Id:
XP_030108742 ⟸ XM_030252882
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_030108743 ⟸ XM_030252883
- Peptide Label:
isoform X2
RefSeq Acc Id:
NP_001343953 ⟸ NM_001357024
- UniProtKB:
Q9DA44 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000103180 ⟸ ENSMUST00000107556
Ensembl Acc Id:
ENSMUSP00000010682 ⟸ ENSMUST00000010682
RGD ID: 6833166 Promoter ID: MM_KWN:34833 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_009836, NM_029801, OTTMUST00000052274, OTTMUST00000052276, UC008PUL.1, UC008PUM.1, UC008PUN.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 88,099,871 - 88,101,327 (-) MPROMDB
RGD ID: 6881112 Promoter ID: EPDNEW_M4007 Type: initiation region Name: Tsacc_1 Description: Mus musculus TSSK6 activating co-chaperone , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 88,296,902 - 88,296,962 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-09-19
Tsacc
TSSK6 activating co-chaperone
1700021C14Rik
RIKEN cDNA 1700021C14 gene
Symbol and/or name change
5135510 APPROVED
