Advanced Search (OLGA)

Gene: Cops6 (COP9 signalosome subunit 6) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Cops6

Name:

COP9 signalosome subunit 6

RGD ID:

1320521

MGI Page

MGI

Description:

Predicted to enable metallopeptidase activity. Predicted to be involved in protein deneddylation. Part of COP9 signalosome. Is expressed in several structures, including brown fat; central nervous system; male reproductive system; sensory organ; and urinary system. Orthologous to human COPS6 (COP9 signalosome subunit 6).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

COP9 (constitutive photomorphogenic) homolog, subunit 6; COP9 (constitutive photomorphogenic), subunit 6; COP9 complex S6; COP9 signalosome complex subunit 6; JAB1-containing signalosome subunit 6; Sg; Sgn3; SGN6; signalosome subunit 6; VIP/; VIP/MOV34

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	COPS6 (COP9 signalosome subunit 6)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Cops6 (COP9 signalosome subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cops6 (COP9 signalosome subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	COPS6 (COP9 signalosome subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	COPS6 (COP9 signalosome subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cops6 (COP9 signalosome subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	COPS6 (COP9 signalosome subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	COPS6 (COP9 signalosome subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cops6 (COP9 signalosome subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Cops6 (COP9 signalosome subunit 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	COPS6 (COP9 signalosome subunit 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cops6 (COP9 signalosome subunit 6)	Alliance	DIOPT (ZFIN)
Drosophila melanogaster (fruit fly):	CSN6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	csn-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	cops6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	138,159,364 - 138,162,246 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	138,159,333 - 138,162,908 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	138,161,102 - 138,163,984 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	138,161,071 - 138,164,646 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	138,602,330 - 138,605,212 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	138,390,890 - 138,393,772 (+)	NCBI		MGSCv36	mm8
Celera	5	135,140,434 - 135,143,316 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	76.97	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cops6	Mouse	pleomorphic xanthoastrocytoma		ISO	COPS6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358
Cops6	Mouse	prostate cancer		ISO	COPS6 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar	PMID:23265383

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cops6	Mouse	human immunodeficiency virus infectious disease		ISO	COPS6 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:15308739

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cops6	Mouse	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of COPS6 mRNA	CTD	PMID:17942748
Cops6	Mouse	17alpha-ethynylestradiol	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPS6 mRNA	CTD	PMID:17942748
Cops6	Mouse	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of COPS6 mRNA	CTD	PMID:39298647
Cops6	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPS6 mRNA	CTD	PMID:17942748
Cops6	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Cops6 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of COPS6 mRNA	CTD	PMID:34747641
Cops6	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of COPS6 mRNA	CTD	PMID:21570461
Cops6	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of COPS6 mRNA	CTD	PMID:39298647
Cops6	Mouse	antirheumatic drug	increases expression	ISO	COPS6 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of COPS6 mRNA	CTD	PMID:24449571
Cops6	Mouse	aristolochic acid A	decreases expression	ISO	COPS6 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of COPS6 mRNA	CTD	PMID:33212167
Cops6	Mouse	arsenite(3-)	multiple interactions	ISO	COPS6 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to COPS6 mRNA]	CTD	PMID:32406909
Cops6	Mouse	arsenous acid	increases expression	ISO	COPS6 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of COPS6 protein	CTD	PMID:25419056
Cops6	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of COPS6 mRNA	CTD	PMID:22228805
Cops6	Mouse	bisphenol A	decreases expression	ISO	Cops6 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of COPS6 mRNA	CTD	PMID:26982218
Cops6	Mouse	bisphenol A	increases expression	ISO	COPS6 (Homo sapiens)	6480464	bisphenol A results in increased expression of COPS6 protein	CTD	PMID:37567409
Cops6	Mouse	bisphenol A	increases methylation	ISO	Cops6 (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of COPS6 gene	CTD	PMID:28505145
Cops6	Mouse	bisphenol A	increases expression	ISO	Cops6 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of COPS6 mRNA	CTD	PMID:25181051
Cops6	Mouse	bisphenol AF	increases expression	ISO	COPS6 (Homo sapiens)	6480464	bisphenol AF results in increased expression of COPS6 protein	CTD	PMID:34186270
Cops6	Mouse	bisphenol F	increases expression	EXP		6480464	bisphenol F results in increased expression of COPS6 mRNA	CTD	PMID:38685157
Cops6	Mouse	cadmium atom	multiple interactions	ISO	COPS6 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of COPS6 mRNA	CTD	PMID:35301059
Cops6	Mouse	cadmium dichloride	multiple interactions	ISO	COPS6 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of COPS6 mRNA	CTD	PMID:35301059
Cops6	Mouse	clofibrate	multiple interactions	EXP		6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of COPS6 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of COPS6 mRNA]	CTD	PMID:17585979
Cops6	Mouse	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of COPS6 mRNA	CTD	PMID:23811191
Cops6	Mouse	cobalt dichloride	decreases expression	ISO	COPS6 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of COPS6 mRNA	CTD	PMID:19320972 and PMID:19376846
Cops6	Mouse	copper(II) sulfate	decreases expression	ISO	COPS6 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of COPS6 mRNA	CTD	PMID:19549813
Cops6	Mouse	diarsenic trioxide	increases expression	ISO	COPS6 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of COPS6 protein	CTD	PMID:25419056
Cops6	Mouse	Dibutyl phosphate	affects expression	ISO	COPS6 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of COPS6 mRNA	CTD	PMID:37042841
Cops6	Mouse	dichloroacetic acid	increases expression	EXP		6480464	Dichloroacetic Acid results in increased expression of COPS6 mRNA	CTD	PMID:28962523
Cops6	Mouse	ethanol	decreases expression	ISO	Cops6 (Rattus norvegicus)	6480464	Ethanol results in decreased expression of COPS6 mRNA	CTD	PMID:17618662
Cops6	Mouse	ethanol	affects splicing	EXP		6480464	Ethanol affects the splicing of COPS6 mRNA	CTD	PMID:30319688
Cops6	Mouse	ethanol	multiple interactions	ISO	Cops6 (Rattus norvegicus)	6480464	[Dronabinol co-treated with Ethanol] results in decreased expression of COPS6 mRNA	CTD	PMID:17618662
Cops6	Mouse	flutamide	increases expression	ISO	Cops6 (Rattus norvegicus)	6480464	Flutamide results in increased expression of COPS6 mRNA	CTD	PMID:24136188
Cops6	Mouse	ivermectin	decreases expression	ISO	COPS6 (Homo sapiens)	6480464	Ivermectin results in decreased expression of COPS6 protein	CTD	PMID:32959892
Cops6	Mouse	methylmercury chloride	decreases expression	ISO	COPS6 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of COPS6 mRNA	CTD	PMID:28001369
Cops6	Mouse	nitrates	multiple interactions	EXP		6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of COPS6 mRNA	CTD	PMID:35964746
Cops6	Mouse	paracetamol	multiple interactions	EXP		6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of COPS6 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of COPS6 mRNA]	CTD	PMID:17585979
Cops6	Mouse	pirinixic acid	multiple interactions	EXP		6480464	PPARA protein promotes the reaction [pirinixic acid results in increased expression of COPS6 mRNA]	CTD	PMID:20059764
Cops6	Mouse	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of COPS6 mRNA	CTD	PMID:18301758 more ...
Cops6	Mouse	SB 431542	multiple interactions	ISO	COPS6 (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of COPS6 protein	CTD	PMID:37664457
Cops6	Mouse	tert-butyl hydroperoxide	decreases expression	ISO	COPS6 (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of COPS6 mRNA	CTD	PMID:15336504
Cops6	Mouse	thiram	decreases expression	ISO	COPS6 (Homo sapiens)	6480464	Thiram results in decreased expression of COPS6 mRNA	CTD	PMID:38568856
Cops6	Mouse	urethane	decreases expression	ISO	COPS6 (Homo sapiens)	6480464	Urethane results in decreased expression of COPS6 mRNA	CTD	PMID:28818685
Cops6	Mouse	valproic acid	increases expression	ISO	COPS6 (Homo sapiens)	6480464	Valproic Acid results in increased expression of COPS6 mRNA	CTD	PMID:23179753
Cops6	Mouse	valproic acid	affects expression	ISO	COPS6 (Homo sapiens)	6480464	Valproic Acid affects the expression of COPS6 mRNA	CTD	PMID:25979313
Cops6	Mouse	vinclozolin	decreases expression	ISO	Cops6 (Rattus norvegicus)	6480464	vinclozolin results in decreased expression of COPS6 mRNA	CTD	PMID:23034163
Cops6	Mouse	vitamin E	increases expression	ISO	COPS6 (Homo sapiens)	6480464	Vitamin E results in increased expression of COPS6 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cops6	Mouse	protein deneddylation	involved_in	IEA	UniProtKB:Q7L5N1 and ensembl:ENSP00000304102	2290270		Ensembl	GO_REF:0000107
Cops6	Mouse	protein deneddylation	involved_in	ISO	UniProtKB:Q7L5N1	2290270		GO_Central	GO_REF:0000119

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cops6	Mouse	COP9 signalosome	part_of	IBA	PANTHER:PTN000057105 more ...	2290270		GO_Central	GO_REF:0000033
Cops6	Mouse	COP9 signalosome	part_of	ISO	UniProtKB:Q7L5N1	2290270		GO_Central	GO_REF:0000119
Cops6	Mouse	COP9 signalosome	part_of	IDA		2290270	PMID:9707402	MGI	PMID:9707402
Cops6	Mouse	cytoplasm	located_in	ISO	UniProtKB:Q7L5N1	2290270		GO_Central	GO_REF:0000119
Cops6	Mouse	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	2290270		UniProt	GO_REF:0000044
Cops6	Mouse	nucleoplasm	located_in	ISO	UniProtKB:Q7L5N1	2290270		GO_Central	GO_REF:0000119
Cops6	Mouse	nucleoplasm	located_in	IEA	UniProtKB:Q7L5N1 and ensembl:ENSP00000304102	2290270		Ensembl	GO_REF:0000107
Cops6	Mouse	nucleus	located_in	ISO	UniProtKB:Q7L5N1	2290270		GO_Central	GO_REF:0000119

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cops6	Mouse	metallopeptidase activity	enables	IEA	InterPro:IPR000555	2290270		InterPro	GO_REF:0000002
Cops6	Mouse	protein binding	enables	IPI	PR:O35864 more ...	2290270	PMID:9707402	MGI	PMID:9707402

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cops6	Mouse	decreased embryo size		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	decreased incidence of tumors by ionizing radiation induction		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	embryonic growth retardation		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	embryonic lethality between implantation and somite formation, complete penetrance		IEA		5509061		MGI
Cops6	Mouse	embryonic lethality between somite formation and embryo turning, incomplete penetrance		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	embryonic lethality during organogenesis, complete penetrance		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	increased cellular sensitivity to gamma-irradiation		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	increased incidence of tumors by ionizing radiation induction		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	increased mortality induced by gamma-irradiation		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	increased sensitivity to induced cell death		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	increased thymocyte apoptosis		IAGP		5509061		MGI	PMID:21317535
Cops6	Mouse	prenatal lethality, complete penetrance		IAGP		5509061		MGI	PMID:21317535

#	Reference Title	Reference Citation
1.	Mouse brain organization revealed through direct genome-scale TF expression analysis.	Gray PA, etal., Science 2004 Dec 24;306(5705):2255-7.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	The COP9 complex is conserved between plants and mammals and is related to the 26S proteasome regulatory complex.	Wei N, etal., Curr Biol 1998 Jul 30-Aug 13;8(16):919-22.

PMID:8889548	PMID:10349636	PMID:10782111	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11337588	PMID:11704659	PMID:12466851	PMID:12477932	PMID:12520002
PMID:14610273	PMID:15226823	PMID:15451666	PMID:15489334	PMID:16141072	PMID:16141073	PMID:16602821	PMID:18287559	PMID:21317535	PMID:21873635	PMID:22956996	PMID:22988430
PMID:24973710	PMID:25395170	PMID:25863250	PMID:26365490	PMID:27113764	PMID:27325702	PMID:28190767	PMID:29991022	PMID:32325033	PMID:32882218	PMID:33857019	PMID:33911869

Cops6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	138,159,364 - 138,162,246 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	138,159,333 - 138,162,908 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	138,161,102 - 138,163,984 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	138,161,071 - 138,164,646 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	138,602,330 - 138,605,212 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	138,390,890 - 138,393,772 (+)	NCBI		MGSCv36	mm8
Celera	5	135,140,434 - 135,143,316 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	76.97	NCBI

COPS6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	100,088,969 - 100,092,187 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	100,088,969 - 100,092,187 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	99,686,592 - 99,689,810 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	99,524,519 - 99,527,759 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	99,331,233 - 99,334,471	NCBI
Celera	7	94,421,242 - 94,424,482 (+)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	94,322,234 - 94,325,474 (+)	NCBI		HuRef
CHM1_1	7	99,616,742 - 99,619,982 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	101,328,815 - 101,332,033 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	99,046,703 - 99,049,943 (+)	NCBI

Cops6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	22,152,688 - 22,155,527 (+)	NCBI		GRCr8
mRatBN7.2	12	17,038,979 - 17,041,818 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	17,038,979 - 17,046,371 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	17,862,350 - 17,865,183 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	18,486,094 - 18,488,927 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	17,539,500 - 17,542,333 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	19,303,387 - 19,306,226 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	19,303,387 - 19,306,226 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	21,361,017 - 21,363,856 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	17,604,017 - 17,606,856 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	17,587,845 - 17,596,347 (+)	NCBI
Celera	12	18,969,149 - 18,971,988 (+)	NCBI		Celera
Cytogenetic Map	12	q11	NCBI

Cops6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955573	770,271 - 775,489 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955573	770,271 - 775,222 (-)	NCBI	ChiLan1.0	ChiLan1.0

COPS6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	118,008,389 - 118,011,377 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	166,273,021 - 166,276,006 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	92,124,166 - 92,127,165 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	105,557,778 - 105,560,998 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	105,557,778 - 105,560,998 (+)	Ensembl	panpan1.1		panPan2

COPS6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	9,500,715 - 9,503,481 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	9,500,724 - 9,503,328 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
ROS_Cfam_1.0	6	9,437,718 - 9,440,669 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	9,437,717 - 9,440,346 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	9,287,044 - 9,289,721 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	9,267,344 - 9,270,300 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	9,446,955 - 9,449,633 (-)	NCBI		UU_Cfam_GSD_1.0

Cops6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	133,798,483 - 133,801,487 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	235,089 - 240,440 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	235,087 - 237,779 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

COPS6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	7,982,892 - 8,005,633 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	8,002,702 - 8,005,545 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

COPS6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	12,986,194 - 12,989,189 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	12,986,346 - 12,989,174 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	3,283,730 - 3,286,718 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cops6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	16,894,626 - 16,899,934 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	16,894,625 - 16,899,369 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cops6
139 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	677
Count of miRNA genes:	426
Interacting mature miRNAs:	480
Transcripts:	ENSMUST00000019638, ENSMUST00000110951, ENSMUST00000127881, ENSMUST00000132639, ENSMUST00000154867
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
27226719	Tibw6_m	tibia width 6, proximal, 16 week (mouse)					5	72857343	139985755	Mouse
1301715	Elmaz2_m	elevated maze behavior 2 (mouse)			Not determined		5	125178229	141700466	Mouse
10412191	Bbaa24_m	B.burgdorferi-associated arthritis 24 (mouse)			Not determined		5	119945037	141700466	Mouse
13464143	Bbaa2b_m	B.burgdorferi-associated arthritis 2b (mouse)					5	133052969	140709801	Mouse
11528552	Scram1_m	spinal cord resistance to astrocytoma modifier 1 (mouse)					5	121455402	151758149	Mouse
1300827	Cora1_m	correlation in cytokine production 1 (mouse)			Not determined		5	115156883	149157015	Mouse
10412239	Alpq7_m	alcohol preference QTL 7 (mouse)			Not determined		5	104705939	138705939	Mouse
12880406	Jcdq2_m	joint cartilage degeneration QTL 2 (mouse)					5	129787831	151758149	Mouse
4141218	Ath24_m	atherosclerosis 24 (mouse)			Not determined			129520084	151758149	Mouse
1301363	Pbwg13_m	postnatal body weight growth 13 (mouse)			Not determined		5	125133457	151758149	Mouse
1301362	Prnr1_m	prion resistance 1 (mouse)			Not determined		5	89418876	146787935	Mouse
1300913	Bwefm_m	body weight females and males day 10 (mouse)			Not determined		5	109439348	143439459	Mouse
4141081	Nidd7k_m	Nidd7 on KK-A (mouse)			Not determined			119945037	149347326	Mouse
10043890	Trigq4_m	triglyceride QTL 4 (mouse)			Not determined		5	107906299	141906412	Mouse
1302079	Lbw3_m	lupus NZB x NZW 3 (mouse)			Not determined		5	124700335	151758149	Mouse
1301986	Bpq4_m	blood pressure QTL 4 (mouse)			Not determined		5	121555236	151758149	Mouse
1301857	Bglq14_m	body growth late QTL 14 (mouse)			Not determined		5	118948964	151758149	Mouse
10412202	Bbaa26_m	B.burgdorferi-associated arthritis 26 (mouse)			Not determined		5	104583688	138555455	Mouse
1301543	Hypch_m	hypercholesterolemia (mouse)			Not determined		5	109238624	139118905	Mouse
4142473	Chlq11_m	circulating hormone level QTL 11 (mouse)			Not determined		5	107906299	141906412	Mouse
13464251	Ahl21_m	age related hearing loss, early onset 21 (mouse)					5	109167240	143167381	Mouse
11341716	Rvfs3_m	Rift Valley fever susceptibility 3 (mouse)					5	26441234	138455402	Mouse
1301226	Bbaa2_m	B.burgdorferi-associated arthritis 2 (mouse)			Not determined		5	115156883	149157015	Mouse
10412197	Bbaa25_m	B.burgdorferi-associated arthritis 25 (mouse)			Not determined		5	109167240	143167381	Mouse
1301102	Cia14_m	collagen induced arthritis 14 (mouse)			Not determined		5	113320385	138555455	Mouse
11049557	Lmr26_m	leishmaniasis resistance 26 (mouse)					5	133925558	151758149	Mouse
13464243	Ahl20_m	age related hearing loss, early onset 20 (mouse)					5	107906299	141906412	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_012002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC151719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF071315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK138409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK146410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK146775	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC004664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC014286	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HB886677	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HC944086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000019638 ⟹ ENSMUSP00000019638

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	138,159,333 - 138,162,908 (+)	Ensembl
GRCm38.p6 Ensembl	5	138,161,071 - 138,164,646 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000110951 ⟹ ENSMUSP00000106576

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	138,159,362 - 138,162,240 (+)	Ensembl
GRCm38.p6 Ensembl	5	138,161,100 - 138,163,978 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000127881

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	138,159,371 - 138,160,646 (+)	Ensembl
GRCm38.p6 Ensembl	5	138,161,109 - 138,162,384 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000132639 ⟹ ENSMUSP00000121554

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	138,161,039 - 138,162,181 (+)	Ensembl
GRCm38.p6 Ensembl	5	138,162,777 - 138,163,919 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000154867

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	138,159,431 - 138,162,401 (+)	Ensembl
GRCm38.p6 Ensembl	5	138,161,169 - 138,164,139 (+)	Ensembl

RefSeq Acc Id:

NM_012002 ⟹ NP_036132

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	5	138,159,364 - 138,162,246 (+)	NCBI
GRCm38	5	138,161,102 - 138,163,984 (+)	ENTREZGENE
MGSCv37	5	138,602,330 - 138,605,212 (+)	RGD
Celera	5	135,140,434 - 135,143,316 (+)	RGD
cM Map	5		ENTREZGENE

Sequence:

show sequence

GCGCGGGGAAAATGGCGGCGGCAGCTGCGGCGGGGGCGAATGGGAGCGGAGGCAGCAGCGGCATGGAAGTGGATGCAGCAGTCCCCAGCGTGATGGCCTCCGGAGTGACTGGGAGTGTTTCCGTCGCT
CTTCATCCCCTTGTCATCCTTAACATCTCAGACCATTGGATCCGCATGCGCTCCCAGGAGGGGCGGCCTATGCAGGTGATTGGGGCTCTGATCGGGAAGCAGGAGGGGCGAAATATCGAAGTGATGAA
CTCCTTTGAGCTGCTGTCCCACACCGTGGAAGAGAAGATTATCATTGACAAAGAATATTATTACACCAAGGAGGAGCAGTTTAAACAGGTTTTCAAGGAGCTGGAGTTTCTGGGTTGGTATACCACAG
GGGGGCCACCTGACCCCTCAGACATCCACGTCCATAAGCAGGTGTGTGAGATAATTGAGAGTCCGCTCTTTCTGAAGTTGAACCCTATGACCAAGCACACAGATCTTCCTGTCAGCGTTTTTGAGTCT
GTCATCGATATAATCAATGGAGAGGCCACAATGCTGTTTGCTGAGCTCACTTACACTCTGGCCACTGAGGAAGCTGAACGGATCGGTGTAGACCACGTGGCCCGGATGACAGCAACAGGCAGTGGGGA
GAACTCCACTGTGGCTGAACACCTGATAGCTCAGCATAGTGCCATCAAGATGCTGCACAGCCGTGTGAAGCTCATTTTAGAATATGTCAAGGCCTCTGAAGCAGGAGAGGTTCCCTTCAACCATGAGA
TCCTGCGGGAGGCCTATGCCCTATGTCACTGTCTTCCAGTTCTCAGCACTGACAAGTTCAAGACAGACTTTTATGATCAATGCAATGACGTGGGGCTCATGGCCTACCTCGGCACCATCACCAAAACG
TGCAACACAATGAACCAGTTTGTGAACAAGTTCAACGTCCTCTACGACCGACAAGGCATTGGCCGGCGAATGCGGGGACTGTTTTTCTGATGATGGTTCTGGAAGGGATGGTGTGTGGGGCTCAGACA
GCTGTTCCATGGACCTGAGTACCACATTCCCTTTAGAGAAACTCATTAATAAAAGAGCAGCCCCTTAGCA

hide sequence


Protein RefSeqs	NP_036132	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC33902	(Get FASTA)	NCBI Sequence Viewer
	AAH04664	(Get FASTA)	NCBI Sequence Viewer
	AAH14286	(Get FASTA)	NCBI Sequence Viewer
	BAE27424	(Get FASTA)	NCBI Sequence Viewer
	CBF67498	(Get FASTA)	NCBI Sequence Viewer
	CBU92371	(Get FASTA)	NCBI Sequence Viewer
	EDL19215	(Get FASTA)	NCBI Sequence Viewer
	EDL19216	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000019638
	ENSMUSP00000019638.9
GenBank Protein	O88545	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036132 ⟸ NM_012002

- UniProtKB:

O88545 (UniProtKB/Swiss-Prot), Q3UIT2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAAAAAGANGSGGSSGMEVDAAVPSVMASGVTGSVSVALHPLVILNISDHWIRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPP
DPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILRE
AYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF

hide sequence

Ensembl Acc Id:

ENSMUSP00000106576 ⟸ ENSMUST00000110951

Ensembl Acc Id:

ENSMUSP00000121554 ⟸ ENSMUST00000132639

Ensembl Acc Id:

ENSMUSP00000019638 ⟸ ENSMUST00000019638

Protein Domains

EIF3F/CSN6-like C-terminal MPN

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88545-F1-model_v2	AlphaFold	O88545	1-324	view protein structure

RGD ID:

6888494

Promoter ID:

EPDNEW_M7698

Type:

multiple initiation site

Name:

Cops6_1

Description:

Mus musculus COP9 signalosome subunit 6 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	5	138,161,091 - 138,161,151	EPDNEW

RGD ID:

6837288

Promoter ID:

MM_KWN:44535

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

OTTMUST00000054245, OTTMUST00000054261, OTTMUST00000054262, UC009AER.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	5	138,602,221 - 138,602,722 (+)	MPROMDB

RGD ID:

6837287

Promoter ID:

MM_KWN:44536

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day2, 3T3L1_Day4, BoneMarrow_0Hour, Kidney

Transcripts:

OTTMUST00000054263

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	5	138,604,014 - 138,604,514 (+)	MPROMDB

RGD ID:

6848820

Promoter ID:

MM_TRO:7879

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day2, 3T3L1_Day3, Kidney

Transcripts:

MTR013548.5.2700.4

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	5	138,604,706 - 138,605,206 (+)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000019494	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000019638	ENTREZGENE
	ENSMUST00000019638.15	UniProtKB/Swiss-Prot
Gene3D-CATH	Cytidine Deaminase, domain 2	UniProtKB/Swiss-Prot
InterPro	JAMM/MPN+_dom	UniProtKB/Swiss-Prot
	MPN	UniProtKB/Swiss-Prot
	MPN_CSN6	UniProtKB/Swiss-Prot
	Rpn11/EIF3F_C	UniProtKB/Swiss-Prot
KEGG Report	mmu:26893	UniProtKB/Swiss-Prot
MGD	MGI:1349439	ENTREZGENE
NCBI Gene	26893	ENTREZGENE
PANTHER	COP9 SIGNALOSOME COMPLEX SUBUNIT 6	UniProtKB/Swiss-Prot
	EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT F-RELATED	UniProtKB/Swiss-Prot
Pfam	JAB	UniProtKB/Swiss-Prot
	MitMem_reg	UniProtKB/Swiss-Prot
PhenoGen	Cops6	PhenoGen
PROSITE	MPN	UniProtKB/Swiss-Prot
SMART	JAB_MPN	UniProtKB/Swiss-Prot
UniProt	CSN6_MOUSE	UniProtKB/Swiss-Prot
	D3Z0F5_MOUSE	UniProtKB/TrEMBL
	F6QK86_MOUSE	UniProtKB/TrEMBL
	O88545	ENTREZGENE
	Q3UIT2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-22	Cops6	COP9 signalosome subunit 6		COP9 (constitutive photomorphogenic) homolog, subunit 6 (Arabidopsis thaliana)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Mammalian Phenotype