Symbol:
Tmeff2
Name:
transmembrane protein with EGF-like and two follistatin-like domains 2
RGD ID:
1318844
MGI Page
MGI
Description:
Predicted to be involved in cell differentiation. Predicted to act upstream of or within negative regulation of cell migration; negative regulation of cellular component organization; and wound healing, spreading of cells. Predicted to be located in membrane. Predicted to be active in extracellular region. Is expressed in several structures, including gut; nervous system; prostate gland; vibrissa; and white fat. Human ortholog(s) of this gene implicated in prostate cancer and urinary bladder cancer. Orthologous to human TMEFF2 (transmembrane protein with EGF like and two follistatin like domains 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
4832418D20Rik; 7630402F16Rik; RIKEN cDNA 7630402F16 gene; tomoregulin-2; TR-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TMEFF2 (transmembrane protein with EGF like and two follistatin like domains 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Tmeff2 (transmembrane protein with EGF-like and two follistatin-like domains 2) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Tmeff2 (transmembrane protein with EGF like and two follistatin like domains 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TMEFF2 (transmembrane protein with EGF like and two follistatin like domains 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TMEFF2 (transmembrane protein with EGF like and two follistatin like domains 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tmeff2 (transmembrane protein with EGF like and two follistatin like domains 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TMEFF2 (transmembrane protein with EGF like and two follistatin like domains 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TMEFF2 (transmembrane protein with EGF like and two follistatin like domains 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tmeff2 (transmembrane protein with EGF like and two follistatin like domains 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Tmeff2 (transmembrane protein with EGF-like and two follistatin-like domains 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TMEFF2 (transmembrane protein with EGF like and two follistatin like domains 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Danio rerio (zebrafish):
tmeff2a (transmembrane protein with EGF-like and two follistatin-like domains 2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
tmeff2b (transmembrane protein with EGF-like and two follistatin-like domains 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
tmeff2
Alliance
DIOPT (OMA|OrthoFinder)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 50,951,946 - 51,226,429 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 50,939,806 - 51,226,429 (+) Ensembl GRCm39 Ensembl GRCm38 1 50,900,683 - 51,187,270 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 50,900,647 - 51,187,270 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 50,984,367 - 51,244,114 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 50,872,068 - 51,131,815 (+) NCBI MGSCv36 mm8 Celera 1 51,227,901 - 51,485,691 (+) NCBI Celera Cytogenetic Map 1 C1.1 NCBI cM Map 1 25.95 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tmeff2 Mouse 1-naphthyl isothiocyanate decreases expression ISO Tmeff2 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in decreased expression of TMEFF2 mRNA CTD PMID:30723492 Tmeff2 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TMEFF2 mRNA CTD PMID:19484750 Tmeff2 Mouse 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO TMEFF2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of TMEFF2 mRNA and Dihydrotestosterone results in increased expression of TMEFF2 protein CTD PMID:23405127 and PMID:29581250 Tmeff2 Mouse 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 AR protein affects the reaction [Dihydrotestosterone results in increased expression of TMEFF2 protein] more ... CTD PMID:23405127 Tmeff2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMEFF2 mRNA CTD PMID:26290441 Tmeff2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO TMEFF2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of TMEFF2 mRNA CTD PMID:29704546 Tmeff2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TMEFF2 mRNA CTD PMID:32553695 Tmeff2 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Tmeff2 Mouse 6-propyl-2-thiouracil decreases expression ISO Tmeff2 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of TMEFF2 mRNA CTD PMID:30047161 Tmeff2 Mouse 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:32553695 Tmeff2 Mouse actinomycin D multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Dihydrotestosterone results in increased expression of TMEFF2 mRNA] CTD PMID:23405127 Tmeff2 Mouse aflatoxin B1 decreases methylation ISO TMEFF2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TMEFF2 gene CTD PMID:27153756 Tmeff2 Mouse all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of TMEFF2 mRNA CTD PMID:16604517 Tmeff2 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of TMEFF2 mRNA CTD PMID:36189433 Tmeff2 Mouse all-trans-retinoic acid increases expression ISO TMEFF2 (Homo sapiens) 6480464 Tretinoin results in increased expression of TMEFF2 mRNA CTD PMID:21934132 and PMID:33167477 Tmeff2 Mouse amitrole decreases expression ISO Tmeff2 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of TMEFF2 mRNA CTD PMID:30047161 Tmeff2 Mouse arsane affects methylation ISO TMEFF2 (Homo sapiens) 6480464 Arsenic affects the methylation of TMEFF2 gene CTD PMID:25304211 Tmeff2 Mouse arsane multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TMEFF2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMEFF2 mRNA CTD PMID:39836092 Tmeff2 Mouse arsenic atom affects methylation ISO TMEFF2 (Homo sapiens) 6480464 Arsenic affects the methylation of TMEFF2 gene CTD PMID:25304211 Tmeff2 Mouse arsenic atom multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TMEFF2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMEFF2 mRNA CTD PMID:39836092 Tmeff2 Mouse arsenite(3-) increases methylation ISO TMEFF2 (Homo sapiens) 6480464 arsenite results in increased methylation of TMEFF2 promoter CTD PMID:23974009 Tmeff2 Mouse arsenous acid decreases expression ISO TMEFF2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TMEFF2 mRNA CTD PMID:26705709 Tmeff2 Mouse atrazine affects methylation ISO Tmeff2 (Rattus norvegicus) 6480464 Atrazine affects the methylation of TMEFF2 gene CTD PMID:35440735 Tmeff2 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of TMEFF2 mRNA CTD PMID:21569818 and PMID:22610609 Tmeff2 Mouse benzo[a]pyrene increases methylation ISO TMEFF2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TMEFF2 5' UTR more ... CTD PMID:27901495 Tmeff2 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of TMEFF2 mRNA and [Benzo(a)pyrene results in increased activity of AHR protein] which results in increased expression of TMEFF2 mRNA CTD PMID:27858113 and PMID:32553695 Tmeff2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene metabolite results in increased expression of TMEFF2 mRNA and Benzo(a)pyrene results in increased expression of TMEFF2 mRNA CTD PMID:27195522 and PMID:32553695 Tmeff2 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO TMEFF2 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 and PMID:20382639 Tmeff2 Mouse benzo[b]fluoranthene decreases expression EXP 6480464 benzo(b)fluoranthene results in decreased expression of TMEFF2 mRNA CTD PMID:26377693 Tmeff2 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of TMEFF2 mRNA CTD PMID:27858113 Tmeff2 Mouse bicalutamide multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 bicalutamide inhibits the reaction [Dihydrotestosterone results in increased expression of TMEFF2 protein] CTD PMID:23405127 Tmeff2 Mouse bis(2-ethylhexyl) phthalate decreases expression ISO TMEFF2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of TMEFF2 mRNA CTD PMID:31163220 Tmeff2 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO Tmeff2 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of TMEFF2 mRNA CTD PMID:31199487 Tmeff2 Mouse bisphenol A decreases expression ISO Tmeff2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of TMEFF2 mRNA CTD PMID:25181051 Tmeff2 Mouse bisphenol A decreases methylation ISO TMEFF2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of TMEFF2 gene CTD PMID:31601247 Tmeff2 Mouse bisphenol A decreases expression ISO TMEFF2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TMEFF2 mRNA CTD PMID:29275510 Tmeff2 Mouse bisphenol A increases methylation ISO Tmeff2 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of TMEFF2 gene CTD PMID:28505145 Tmeff2 Mouse butanal increases expression ISO TMEFF2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of TMEFF2 mRNA CTD PMID:26079696 Tmeff2 Mouse Butylbenzyl phthalate multiple interactions ISO Tmeff2 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of TMEFF2 mRNA CTD PMID:31199487 Tmeff2 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Tmeff2 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of TMEFF2 mRNA CTD PMID:27858113 Tmeff2 Mouse clotrimazole multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [Clotrimazole results in increased phosphorylation of EIF2A protein] which results in increased expression of TMEFF2 protein CTD PMID:23405127 Tmeff2 Mouse diarsenic trioxide decreases expression ISO TMEFF2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TMEFF2 mRNA CTD PMID:26705709 Tmeff2 Mouse dibenz[a,h]anthracene decreases expression EXP 6480464 1 more ... CTD PMID:26377693 Tmeff2 Mouse dibutyl phthalate multiple interactions ISO Tmeff2 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of TMEFF2 mRNA CTD PMID:31199487 Tmeff2 Mouse diethyl phthalate multiple interactions ISO Tmeff2 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of TMEFF2 mRNA CTD PMID:31199487 Tmeff2 Mouse diisobutyl phthalate multiple interactions ISO Tmeff2 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of TMEFF2 mRNA CTD PMID:31199487 Tmeff2 Mouse diisononyl phthalate multiple interactions ISO Tmeff2 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of TMEFF2 mRNA CTD PMID:31199487 Tmeff2 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TMEFF2 mRNA CTD PMID:30529165 Tmeff2 Mouse dorsomorphin multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tmeff2 Mouse entinostat decreases expression ISO TMEFF2 (Homo sapiens) 6480464 entinostat results in decreased expression of TMEFF2 mRNA CTD PMID:27188386 Tmeff2 Mouse entinostat multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TMEFF2 mRNA CTD PMID:27188386 Tmeff2 Mouse entinostat increases expression ISO TMEFF2 (Homo sapiens) 6480464 entinostat results in increased expression of TMEFF2 mRNA CTD PMID:26272509 Tmeff2 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of TMEFF2 mRNA CTD PMID:30319688 Tmeff2 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of TMEFF2 mRNA CTD PMID:30319688 Tmeff2 Mouse ethyl methanesulfonate decreases expression ISO TMEFF2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of TMEFF2 mRNA CTD PMID:23649840 Tmeff2 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of TMEFF2 mRNA CTD PMID:25629700 Tmeff2 Mouse folic acid increases expression ISO TMEFF2 (Homo sapiens) 6480464 Folic Acid results in increased expression of TMEFF2 mRNA CTD PMID:28752528 Tmeff2 Mouse fonofos increases methylation ISO TMEFF2 (Homo sapiens) 6480464 Fonofos results in increased methylation of TMEFF2 promoter CTD PMID:22847954 Tmeff2 Mouse fragrance increases expression ISO TMEFF2 (Homo sapiens) 6480464 Perfume results in increased expression of TMEFF2 mRNA CTD PMID:24768652 Tmeff2 Mouse furan increases expression ISO Tmeff2 (Rattus norvegicus) 6480464 furan results in increased expression of TMEFF2 mRNA CTD PMID:27387713 Tmeff2 Mouse indometacin decreases expression ISO TMEFF2 (Homo sapiens) 6480464 Indomethacin results in decreased expression of TMEFF2 mRNA CTD PMID:16984733 Tmeff2 Mouse ketamine decreases expression ISO Tmeff2 (Rattus norvegicus) 6480464 Ketamine results in decreased expression of TMEFF2 mRNA CTD PMID:20080153 Tmeff2 Mouse lead(0) increases expression ISO TMEFF2 (Homo sapiens) 6480464 Lead results in increased expression of TMEFF2 mRNA CTD PMID:19921347 Tmeff2 Mouse manganese atom multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TMEFF2 mRNA CTD PMID:39836092 Tmeff2 Mouse manganese(0) multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TMEFF2 mRNA CTD PMID:39836092 Tmeff2 Mouse manganese(II) chloride multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TMEFF2 mRNA CTD PMID:39836092 Tmeff2 Mouse methoxychlor affects methylation ISO Tmeff2 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of TMEFF2 gene CTD PMID:35440735 Tmeff2 Mouse methylmercury chloride increases expression ISO TMEFF2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of TMEFF2 mRNA CTD PMID:28001369 Tmeff2 Mouse mono(2-ethylhexyl) phthalate decreases expression ISO TMEFF2 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of TMEFF2 mRNA CTD PMID:36695872 Tmeff2 Mouse mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of TMEFF2 mRNA CTD PMID:36189433 Tmeff2 Mouse N,N-diethyl-m-toluamide multiple interactions ISO Tmeff2 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in increased methylation of TMEFF2 gene CTD PMID:33148267 Tmeff2 Mouse N-methyl-4-phenylpyridinium decreases expression ISO TMEFF2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of TMEFF2 mRNA CTD PMID:24810058 Tmeff2 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of TMEFF2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of TMEFF2 mRNA CTD PMID:34911549 Tmeff2 Mouse paracetamol increases expression ISO Tmeff2 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of TMEFF2 mRNA CTD PMID:33387578 Tmeff2 Mouse parathion increases methylation ISO TMEFF2 (Homo sapiens) 6480464 Parathion results in increased methylation of TMEFF2 promoter CTD PMID:22847954 Tmeff2 Mouse permethrin multiple interactions ISO Tmeff2 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in increased methylation of TMEFF2 gene CTD PMID:33148267 Tmeff2 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of TMEFF2 mRNA CTD PMID:23091169 Tmeff2 Mouse phenylmercury acetate increases expression ISO TMEFF2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of TMEFF2 mRNA CTD PMID:26272509 Tmeff2 Mouse phenylmercury acetate multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TMEFF2 mRNA CTD PMID:27188386 Tmeff2 Mouse Rutecarpine decreases expression ISO TMEFF2 (Homo sapiens) 6480464 rutecarpine results in decreased expression of TMEFF2 mRNA CTD PMID:34955744 Tmeff2 Mouse SB 431542 multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Tmeff2 Mouse silicon dioxide decreases expression ISO TMEFF2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of TMEFF2 mRNA CTD PMID:25895662 Tmeff2 Mouse silicon dioxide increases expression ISO TMEFF2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of TMEFF2 mRNA CTD PMID:23806026 Tmeff2 Mouse sodium arsenite increases expression ISO TMEFF2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TMEFF2 mRNA CTD PMID:22714537 Tmeff2 Mouse sodium arsenite multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TMEFF2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of TMEFF2 mRNA CTD PMID:39836092 Tmeff2 Mouse sulfadimethoxine decreases expression ISO Tmeff2 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of TMEFF2 mRNA CTD PMID:30047161 Tmeff2 Mouse sulforaphane decreases expression EXP 6480464 sulforaphane results in decreased expression of TMEFF2 mRNA CTD PMID:30529165 Tmeff2 Mouse temozolomide decreases expression ISO TMEFF2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of TMEFF2 mRNA CTD PMID:31758290 Tmeff2 Mouse terbufos increases methylation ISO TMEFF2 (Homo sapiens) 6480464 terbufos results in increased methylation of TMEFF2 promoter CTD PMID:22847954 Tmeff2 Mouse tetrachloromethane increases expression ISO Tmeff2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of TMEFF2 mRNA CTD PMID:31150632 Tmeff2 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of TMEFF2 mRNA CTD PMID:27858113 Tmeff2 Mouse thimerosal increases expression ISO TMEFF2 (Homo sapiens) 6480464 Thimerosal results in increased expression of TMEFF2 mRNA CTD PMID:27188386 Tmeff2 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of TMEFF2 mRNA CTD PMID:23557971 and PMID:27760801 Tmeff2 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of TMEFF2 gene and titanium dioxide results in decreased methylation of TMEFF2 promoter CTD PMID:35295148 Tmeff2 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of TMEFF2 gene CTD PMID:35295148 Tmeff2 Mouse trichloroethene increases expression ISO Tmeff2 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of TMEFF2 mRNA CTD PMID:33387578 Tmeff2 Mouse trichostatin A decreases expression ISO TMEFF2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of TMEFF2 mRNA CTD PMID:24935251 Tmeff2 Mouse trichostatin A increases expression ISO TMEFF2 (Homo sapiens) 6480464 trichostatin A results in increased expression of TMEFF2 mRNA CTD PMID:24935251 Tmeff2 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of TMEFF2 mRNA CTD PMID:33045310 Tmeff2 Mouse valproic acid affects expression ISO TMEFF2 (Homo sapiens) 6480464 Valproic Acid affects the expression of TMEFF2 mRNA CTD PMID:23179753 and PMID:25979313 Tmeff2 Mouse valproic acid increases expression ISO TMEFF2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TMEFF2 mRNA CTD PMID:19101580 more ... Tmeff2 Mouse valproic acid multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TMEFF2 mRNA CTD PMID:27188386 Tmeff2 Mouse valproic acid decreases expression ISO TMEFF2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TMEFF2 mRNA CTD PMID:27188386 and PMID:28001369 Tmeff2 Mouse vorinostat decreases expression ISO TMEFF2 (Homo sapiens) 6480464 vorinostat results in decreased expression of TMEFF2 mRNA CTD PMID:27188386 Tmeff2 Mouse vorinostat multiple interactions ISO TMEFF2 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TMEFF2 mRNA CTD PMID:27188386 Tmeff2 Mouse vorinostat increases expression ISO TMEFF2 (Homo sapiens) 6480464 vorinostat results in increased expression of TMEFF2 mRNA CTD PMID:26272509
1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) amitrole (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (EXP) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) carbon nanotube (EXP) chrysene (EXP) clotrimazole (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (EXP) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (EXP) dorsomorphin (ISO) entinostat (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) folic acid (EXP,ISO) fonofos (ISO) fragrance (ISO) furan (ISO) indometacin (ISO) ketamine (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methoxychlor (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (EXP,ISO) N,N-diethyl-m-toluamide (ISO) N-methyl-4-phenylpyridinium (ISO) ozone (EXP) paracetamol (ISO) parathion (ISO) permethrin (ISO) phenobarbital (EXP) phenylmercury acetate (ISO) Rutecarpine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfadimethoxine (ISO) sulforaphane (EXP) temozolomide (ISO) terbufos (ISO) tetrachloromethane (ISO) tetraphene (EXP) thimerosal (ISO) titanium dioxide (EXP) trichloroethene (ISO) trichostatin A (ISO) triptonide (EXP) valproic acid (ISO) vorinostat (ISO)
1.
Preclinical validation of anti-TMEFF2-auristatin E-conjugated antibodies in the treatment of prostate cancer.
Afar DE, etal., Mol Cancer Ther. 2004 Aug;3(8):921-32.
2.
Gene expression in the LNCaP human prostate cancer progression model: progression associated expression in vitro corresponds to expression changes associated with prostate cancer progression in vivo.
Chen Q, etal., Cancer Lett. 2006 Dec 8;244(2):274-88. Epub 2006 Feb 23.
3.
MGDs mouse GO annotations
MGD data from the GO Consortium
4.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
DNA methylation-associated inactivation of TGFbeta-related genes DRM/Gremlin, RUNX3, and HPP1 in human cancers.
Suzuki M, etal., Br J Cancer. 2005 Oct 31;93(9):1029-37.
9.
Methylation of apoptosis related genes in the pathogenesis and prognosis of prostate cancer.
Suzuki M, etal., Cancer Lett. 2006 Oct 28;242(2):222-30. Epub 2006 Feb 3.
Tmeff2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 50,951,946 - 51,226,429 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 50,939,806 - 51,226,429 (+) Ensembl GRCm39 Ensembl GRCm38 1 50,900,683 - 51,187,270 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 50,900,647 - 51,187,270 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 50,984,367 - 51,244,114 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 50,872,068 - 51,131,815 (+) NCBI MGSCv36 mm8 Celera 1 51,227,901 - 51,485,691 (+) NCBI Celera Cytogenetic Map 1 C1.1 NCBI cM Map 1 25.95 NCBI
TMEFF2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 191,949,046 - 192,194,933 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 191,949,043 - 192,194,933 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 192,813,772 - 193,059,659 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 192,522,988 - 192,767,889 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 192,640,254 - 192,885,150 NCBI Celera 2 186,409,789 - 186,655,054 (-) NCBI Celera Cytogenetic Map 2 q32.3 NCBI HuRef 2 184,672,895 - 184,920,068 (-) NCBI HuRef CHM1_1 2 192,820,711 - 193,065,780 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 192,437,261 - 192,683,624 (-) NCBI T2T-CHM13v2.0
Tmeff2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 57,937,873 - 58,225,372 (-) NCBI GRCr8 mRatBN7.2 9 50,445,947 - 50,733,473 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 50,436,079 - 50,733,475 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 58,992,474 - 59,279,503 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 64,115,319 - 64,402,348 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 62,411,281 - 62,698,306 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 55,379,130 - 55,673,704 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 55,384,100 - 55,673,829 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 55,079,810 - 55,369,414 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 47,519,306 - 47,811,472 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 47,522,306 - 47,812,884 (-) NCBI Celera 9 48,081,045 - 48,369,704 (-) NCBI Celera Cytogenetic Map 9 q22 NCBI
Tmeff2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 7,121,834 - 7,354,908 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 7,122,019 - 7,353,769 (+) NCBI ChiLan1.0 ChiLan1.0
TMEFF2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 94,623,048 - 94,863,209 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 94,638,032 - 94,878,190 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 79,242,825 - 79,489,113 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 197,157,426 - 197,397,439 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 197,158,689 - 197,396,254 (-) Ensembl panpan1.1 panPan2
TMEFF2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 2,414,208 - 2,635,283 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 37 2,414,440 - 2,635,431 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 3,361,937 - 3,582,835 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 2,303,017 - 2,524,548 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 2,303,191 - 2,524,547 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 2,312,184 - 2,533,428 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 2,279,821 - 2,500,794 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 2,292,309 - 2,514,442 (-) NCBI UU_Cfam_GSD_1.0
Tmeff2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 150,461,820 - 150,724,361 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936506 6,114,108 - 6,355,200 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936506 6,113,521 - 6,375,986 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TMEFF2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 96,594,970 - 96,855,743 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 96,594,901 - 96,856,848 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 108,167,977 - 108,396,883 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TMEFF2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 77,491,041 - 77,735,890 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 77,490,095 - 77,735,849 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 121,733,118 - 121,975,654 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tmeff2
.
Predicted Target Of
Count of predictions: 630 Count of miRNA genes: 376 Interacting mature miRNAs: 459 Transcripts: ENSMUST00000081851, ENSMUST00000114565, ENSMUST00000139157 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 1357524 W6q14_m weight 6 weeks QTL 14 (mouse) Not determined 1 34760138 73976915 Mouse 12910788 Pwgrq9_m post-weaning growth rate QTL 9 (mouse) 1 40868008 67270256 Mouse 1301714 Vertcling_m vertical clinging (mouse) Not determined 1 42938031 76938167 Mouse 1301073 Orch5_m autoimmune orchitis resistance 5 (mouse) Not determined 1 19065351 53065454 Mouse 18182931 Metl1_m metabolite locus 1, pyridoxate (mouse) 1 41275399 75275399 Mouse 1357651 Lgq5_m late growth QTL 5 (mouse) Not determined 1 34760138 73976915 Mouse 12910786 Pwgrq10_m post-weaning growth rate QTL 10 (mouse) 1 40868008 67270256 Mouse 11100001 Col4a1m1_m collagen, type IV, alpha 1 modifier 1 (mouse) 1 25550191 62946882 Mouse 1301211 Bbaa11_m B.burgdorferi-associated arthritis 11 (mouse) Not determined 1 48889006 82889210 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 1357721 Sle17_m systematic lupus erythematosus susceptibility 17 (mouse) Not determined 1 39132808 126445310 Mouse 10412179 Habiir1_m hyperoxic acute lung injury imprinted region 1 (mouse) Not determined 1 45417773 51964119 Mouse 1558855 Eae30_m experimental allergic encephalomyelitis susceptibility 30 (mouse) Not determined 1 45417773 72975057 Mouse 1301954 Lrnx11_m learning-contextual 11 (mouse) Not determined 1 39132808 74516365 Mouse 12880407 V125Dq2_m vitamin D active form serum level QTL 2 (mouse) 1 19339081 53339081 Mouse 1357824 Estoq4_m embryo survival total QTL 4 (mouse) Not determined 1 34760138 73976915 Mouse 1357506 W10q6_m weight 10 weeks QTL 6 (mouse) Not determined 1 34760138 73976915 Mouse 4141032 Wbcc1_m white blood cell count 1 (mouse) Not determined 42259667 76259667 Mouse 39128207 Lwq16_m liver weight QTL 16 (mouse) 1 34760138 73976915 Mouse 1558860 W10q7_m weight 10 weeks QTL 7 (mouse) Not determined 1 34760138 150193871 Mouse 12880409 V125Dq1_m vitamin D active form serum level QTL 1 (mouse) 1 26039160 60039160 Mouse 4142433 Hbnr1_m Heligmosomoides bakeri nematode resistance 1 (mouse) Not determined 25550191 58273271 Mouse 1301616 Yaa2_m Y-linked autoimmune acceleration 2 (mouse) Not determined 1 46854690 80854839 Mouse 1357488 Splq3_m spleen weight QTL 3 (mouse) Not determined 1 34760138 150193871 Mouse 10043965 Obq24_m obesity QTL 24 (mouse) Not determined 1 50890216 84890216 Mouse 1301430 Cdcs2_m cytokine deficiency colitis susceptibility 2 (mouse) Not determined 1 48892345 82892485 Mouse 12879917 Shm3_m sperm head morphology 3 (mouse) 1 44186904 62946882 Mouse 1301240 Sluc15_m susceptibility to lung cancer 15 (mouse) Not determined 1 19065351 53065454 Mouse 1357759 W3q12_m weight 3 weeks QTL 12 (mouse) Not determined 1 34760138 73976915 Mouse 1357753 Kidq2_m kidney weight QTL 2 (mouse) Not determined 1 34760138 150193871 Mouse 1558905 Gct7_m granulosa cell tumorigenesis 7 (mouse) Not determined 1 47349894 81350013 Mouse 1301756 Pgia1_m proteoglycan induced arthritis 1 (mouse) Not determined 1 19065351 53065454 Mouse 1558822 Vas1_m autoimmune vasitis resistance 1 (mouse) Not determined 1 48889006 82889210 Mouse 1301670 Ssta1_m susceptibility to Salmonella typhimurium antigens 1 (mouse) Not determined 1 45946755 79946882 Mouse 1357475 w3q13_m weight 3 weeks QTL 13 (mouse) Not determined 1 23109591 73976915 Mouse 12910780 Pwgrq11_m post-weaning growth rate QTL 11 (mouse) 1 40868008 67270256 Mouse 1301225 Sle7_m systematic lupus erythematosus susceptibility 7 (mouse) Not determined 1 46854690 80854839 Mouse 1301166 Thypr2_m thymocyte proliferative response 2 (mouse) Not determined 1 41273124 75273271 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000081851 ⟹ ENSMUSP00000080533
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 50,966,678 - 51,226,429 (+) Ensembl GRCm38.p6 Ensembl 1 50,927,519 - 51,187,270 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000114565 ⟹ ENSMUSP00000110212
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 50,949,121 - 51,019,079 (+) Ensembl GRCm38.p6 Ensembl 1 50,909,962 - 50,979,920 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000139157
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 50,939,806 - 50,954,589 (+) Ensembl GRCm38.p6 Ensembl 1 50,900,647 - 50,915,430 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000186103
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 50,939,806 - 50,953,084 (+) Ensembl GRCm38.p6 Ensembl 1 50,900,647 - 50,913,925 (+) Ensembl
RefSeq Acc Id:
NM_019790 ⟹ NP_062764
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 50,966,682 - 51,226,429 (+) NCBI GRCm38 1 50,927,523 - 51,187,270 (+) NCBI MGSCv37 1 50,984,367 - 51,244,114 (+) RGD Celera 1 51,227,901 - 51,485,691 (+) RGD cM Map 1 ENTREZGENE
Sequence:
GGATGCGGGCGGCAGAGCGCGAGAGGCGGCGGCTGGGCTGCGGGGCGCTGTGACTGTCCCTCCACCCAGTCTGGTCGCGCTCTTCTCTTCGGCCGATTGGCCGCCTCCTCTCCGCACCCTGGTTTCTG
hide sequence
RefSeq Acc Id:
XM_030255650 ⟹ XP_030111510
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 50,951,946 - 51,226,063 (+) NCBI GRCm38 1 50,900,683 - 51,186,904 (+) NCBI
Sequence:
GTTTATCTTGTTCCTAGAAGCATTACAGAGATTACAGAGGTGGATCGGGCCTAATTCACCATTC
hide sequence
RefSeq Acc Id:
XM_036152485 ⟹ XP_036008378
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 50,951,946 - 51,226,063 (+) NCBI
Sequence:
GTTTATCTTGTTCCTAGAAGCATTACAGAGATTACAGAGGTGGATCGGGCCTAATTCACCATTCATTTCTCTCTGTGAGGTAAAGGGTTTCTCACTGAATTTGGAGCTTAATCATTGACCCACCTGGC
hide sequence
RefSeq Acc Id:
NP_062764 ⟸ NM_019790
- Peptide Label:
precursor
- UniProtKB:
Q8CDH1 (UniProtKB/Swiss-Prot), Q3UY20 (UniProtKB/Swiss-Prot), Q9JJE3 (UniProtKB/Swiss-Prot), Q9QYM9 (UniProtKB/Swiss-Prot)
- Sequence:
MVLWESPRQCSSWTLCEGFCWLLLLPVTLLIIARPVKLAAFPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNSDYVPVCGSNGESYQNECYLRQAACKQQSEIL
hide sequence
RefSeq Acc Id:
XP_030111510 ⟸ XM_030255650
- Peptide Label:
isoform X1
- UniProtKB:
Q9QYM9 (UniProtKB/Swiss-Prot), Q8CDH1 (UniProtKB/Swiss-Prot), Q3UY20 (UniProtKB/Swiss-Prot), Q9JJE3 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000080533 ⟸ ENSMUST00000081851
Ensembl Acc Id:
ENSMUSP00000110212 ⟸ ENSMUST00000114565
RefSeq Acc Id:
XP_036008378 ⟸ XM_036152485
- Peptide Label:
isoform X2
RGD ID: 6873652 Promoter ID: EPDNEW_M277 Type: multiple initiation site Name: Tmeff2_1 Description: Mus musculus transmembrane protein with EGF-like and two follistatin-likedomains 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 50,927,536 - 50,927,596 EPDNEW
RGD ID: 6818593 Promoter ID: MM_KWN:672 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, ES_Cell, MEF_B4 Transcripts: ENSMUST00000114567, OTTMUST00000053512 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 50,984,076 - 50,984,576 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-05
Tmeff2
transmembrane protein with EGF-like and two follistatin-like domains 2
7630402f16rik
RIKEN cDNA 7630402F16 gene
Data merged from RGD:1609130
737654 PROVISIONAL
