Symbol:
ZRANB1
Name:
zinc finger RANBP2-type containing 1
RGD ID:
1318817
HGNC Page
HGNC:18224
Description:
Enables K63-linked polyubiquitin modification-dependent protein binding activity and cysteine-type deubiquitinase activity. Involved in several processes, including positive regulation of Wnt signaling pathway; protein deubiquitination; and regulation of cell morphogenesis. Located in cytosol and nucleoplasm. Is active in cytoplasm and nucleus.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DKFZp762P2216; hTrabid; RP11-298J20.4; TRABID; TRAF-binding domain-containing protein; TRAF-binding protein domain; ubiquitin thioesterase ZRANB1; zinc finger Ran-binding domain-containing protein 1; zinc finger, RAN-binding domain containing 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Zranb1 (zinc finger, RAN-binding domain containing 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Zranb1 (zinc finger RANBP2-type containing 1) HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Zranb1 (zinc finger RANBP2-type containing 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
ZRANB1 (zinc finger RANBP2-type containing 1) NCBI
Ortholog
Canis lupus familiaris (dog):
ZRANB1 (zinc finger RANBP2-type containing 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Zranb1 (zinc finger RANBP2-type containing 1) NCBI
Ortholog
Sus scrofa (pig):
ZRANB1 (zinc finger RANBP2-type containing 1) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
ZRANB1 (zinc finger RANBP2-type containing 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Zranb1 (zinc finger RANBP2-type containing 1) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Or7g23e (olfactory receptor family 7 subfamily G member 23E) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Zranb1 (zinc finger, RAN-binding domain containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Zranb1 (zinc finger RANBP2-type containing 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zranb1a (zinc finger, RAN-binding domain containing 1a)
Alliance
DIOPT (Ensembl Compara|OMA|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
zranb1b (zinc finger, RAN-binding domain containing 1b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
trbd
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
zranb1.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
zranb1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
zranb1.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 124,916,894 - 124,988,189 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 124,942,123 - 124,988,189 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 126,630,692 - 126,676,758 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 126,620,682 - 126,665,995 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 126,620,681 - 126,663,759 NCBI Celera 10 120,404,500 - 120,449,814 (+) NCBI Celera Cytogenetic Map 10 q26.13 NCBI HuRef 10 120,317,070 - 120,363,002 (+) NCBI HuRef CHM1_1 10 126,912,463 - 126,957,768 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 125,823,167 - 125,869,209 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
ZRANB1 Human 1,2-dimethylhydrazine decreases expression ISO RGD:1551093 6480464 1,2-Dimethylhydrazine results in decreased expression of ZRANB1 mRNA CTD PMID:22206623 ZRANB1 Human 17beta-estradiol decreases expression ISO RGD:1551093 6480464 Estradiol results in decreased expression of ZRANB1 mRNA CTD PMID:39298647 ZRANB1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1551093 6480464 Tetrachlorodibenzodioxin affects the expression of ZRANB1 mRNA CTD PMID:21570461|PMID:24680724 ZRANB1 Human 2-hydroxypropanoic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of ZRANB1 mRNA CTD PMID:30851411 ZRANB1 Human 4,4'-diaminodiphenylmethane decreases expression ISO RGD:2321751 6480464 4,4'-diaminodiphenylmethane results in decreased expression of ZRANB1 mRNA CTD PMID:30723492 ZRANB1 Human 4,4'-sulfonyldiphenol decreases expression ISO RGD:1551093 6480464 bisphenol S results in decreased expression of ZRANB1 mRNA CTD PMID:39298647 ZRANB1 Human aflatoxin B1 increases expression ISO RGD:1551093 6480464 Aflatoxin B1 results in increased expression of ZRANB1 mRNA CTD PMID:19770486 ZRANB1 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of ZRANB1 mRNA CTD PMID:23724009 ZRANB1 Human antirheumatic drug increases expression EXP 6480464 Antirheumatic Agents results in increased expression of ZRANB1 mRNA CTD PMID:24449571 ZRANB1 Human arsenite(3-) multiple interactions EXP 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ZRANB1 mRNA] CTD PMID:32406909 ZRANB1 Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of ZRANB1 mRNA CTD PMID:20458559 ZRANB1 Human bisphenol A decreases methylation ISO RGD:1551093 6480464 bisphenol A results in decreased methylation of ZRANB1 promoter CTD PMID:27312807 ZRANB1 Human bisphenol A decreases expression ISO RGD:1551093 6480464 bisphenol A results in decreased expression of ZRANB1 mRNA CTD PMID:33221593 ZRANB1 Human bisphenol F decreases expression ISO RGD:1551093 6480464 bisphenol F results in decreased expression of ZRANB1 mRNA CTD PMID:38685157 ZRANB1 Human butanal decreases expression EXP 6480464 butyraldehyde results in decreased expression of ZRANB1 mRNA CTD PMID:26079696 ZRANB1 Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ZRANB1 mRNA CTD PMID:21457566 ZRANB1 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ZRANB1 mRNA CTD PMID:38568856 ZRANB1 Human carbon nanotube decreases expression ISO RGD:1551093 6480464 Nanotubes, Carbon analog results in decreased expression of ZRANB1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 ZRANB1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to ZRANB1 gene] CTD PMID:28238834 ZRANB1 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of ZRANB1 mRNA CTD PMID:19549813 ZRANB1 Human cyclosporin A decreases expression ISO RGD:1551093 6480464 Cyclosporine results in decreased expression of ZRANB1 mRNA CTD PMID:19770486 ZRANB1 Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of ZRANB1 mRNA CTD PMID:20458559 ZRANB1 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of ZRANB1 mRNA CTD PMID:37042841 ZRANB1 Human epoxiconazole decreases expression ISO RGD:1551093 6480464 epoxiconazole results in decreased expression of ZRANB1 mRNA CTD PMID:35436446 ZRANB1 Human fluoranthene multiple interactions ISO RGD:1551093 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of ZRANB1 mRNA CTD PMID:28329830 ZRANB1 Human formaldehyde decreases expression EXP 6480464 Formaldehyde results in decreased expression of ZRANB1 mRNA CTD PMID:20655997 ZRANB1 Human FR900359 increases phosphorylation EXP 6480464 FR900359 results in increased phosphorylation of ZRANB1 protein CTD PMID:37730182 ZRANB1 Human gentamycin increases expression ISO RGD:2321751 6480464 Gentamicins results in increased expression of ZRANB1 mRNA CTD PMID:33387578 ZRANB1 Human methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of ZRANB1 mRNA CTD PMID:28001369 ZRANB1 Human ozone multiple interactions ISO RGD:1551093 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of ZRANB1 more ... CTD PMID:34911549 ZRANB1 Human p-menthan-3-ol decreases expression EXP 6480464 Menthol results in decreased expression of ZRANB1 mRNA CTD PMID:26760959 ZRANB1 Human paracetamol increases expression ISO RGD:2321751 6480464 Acetaminophen results in increased expression of ZRANB1 mRNA CTD PMID:33387578 ZRANB1 Human pentanal decreases expression EXP 6480464 pentanal results in decreased expression of ZRANB1 mRNA CTD PMID:26079696 ZRANB1 Human phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of ZRANB1 mRNA CTD PMID:19159669 ZRANB1 Human pirinixic acid increases expression ISO RGD:1551093 6480464 pirinixic acid results in increased expression of ZRANB1 mRNA CTD PMID:17426115 ZRANB1 Human rac-lactic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of ZRANB1 mRNA CTD PMID:30851411 ZRANB1 Human sodium arsenate increases expression ISO RGD:1551093 6480464 sodium arsenate results in increased expression of ZRANB1 mRNA CTD PMID:21795629 ZRANB1 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ZRANB1 mRNA CTD PMID:38568856 ZRANB1 Human succimer multiple interactions ISO RGD:1551093 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of ZRANB1 mRNA; [Succimer co-treated more ... CTD PMID:21641980|PMID:26378955 ZRANB1 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of ZRANB1 mRNA CTD PMID:31533062 ZRANB1 Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of ZRANB1 mRNA CTD PMID:31758290 ZRANB1 Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of ZRANB1 mRNA CTD PMID:33359661 ZRANB1 Human tetrachloromethane decreases expression ISO RGD:1551093 6480464 Carbon Tetrachloride results in decreased expression of ZRANB1 mRNA CTD PMID:31919559 ZRANB1 Human troglitazone decreases expression ISO RGD:1551093 6480464 troglitazone results in decreased expression of ZRANB1 mRNA CTD PMID:28973697 ZRANB1 Human urethane increases expression EXP 6480464 Urethane results in increased expression of ZRANB1 mRNA CTD PMID:28818685 ZRANB1 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of ZRANB1 mRNA CTD PMID:23179753|PMID:28001369 ZRANB1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of ZRANB1 mRNA CTD PMID:25979313 ZRANB1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ZRANB1 mRNA CTD PMID:29154799
ZRANB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 124,916,894 - 124,988,189 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 124,942,123 - 124,988,189 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 126,630,692 - 126,676,758 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 126,620,682 - 126,665,995 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 126,620,681 - 126,663,759 NCBI Celera 10 120,404,500 - 120,449,814 (+) NCBI Celera Cytogenetic Map 10 q26.13 NCBI HuRef 10 120,317,070 - 120,363,002 (+) NCBI HuRef CHM1_1 10 126,912,463 - 126,957,768 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 125,823,167 - 125,869,209 (+) NCBI T2T-CHM13v2.0
Zranb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 132,532,905 - 132,588,127 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 132,532,871 - 132,588,120 (+) Ensembl GRCm39 Ensembl GRCm38 7 132,931,176 - 132,986,398 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 132,931,142 - 132,986,391 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 140,141,305 - 140,175,634 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 132,787,965 - 132,822,294 (+) NCBI MGSCv36 mm8 Celera 7 132,755,614 - 132,789,937 (+) NCBI Celera Cytogenetic Map 7 F3 NCBI cM Map 7 76.32 NCBI
Zranb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 197,155,048 - 197,211,518 (+) NCBI GRCr8 mRatBN7.2 1 187,725,354 - 187,780,129 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 187,724,320 - 187,779,655 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 1 204,938,444 - 205,000,163 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 204,959,174 - 204,998,019 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 211,931,252 - 211,991,353 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 192,458,649 - 192,461,208 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 185,469,920 - 185,525,817 (+) NCBI Celera Cytogenetic Map 1 q41 NCBI
Zranb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955477 2,873,170 - 2,922,069 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955477 2,864,737 - 2,922,069 (+) NCBI ChiLan1.0 ChiLan1.0
ZRANB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 136,766,528 - 136,837,960 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 136,772,160 - 136,843,311 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 121,477,916 - 121,549,296 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 125,766,209 - 125,814,015 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 125,766,178 - 125,814,768 (+) Ensembl panpan1.1 panPan2
ZRANB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 34,220,596 - 34,259,642 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 34,220,596 - 34,256,620 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 34,264,304 - 34,321,513 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 34,759,763 - 34,817,033 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 34,718,820 - 34,814,205 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 34,316,924 - 34,374,155 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 34,308,002 - 34,365,164 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 34,560,074 - 34,617,303 (+) NCBI UU_Cfam_GSD_1.0
Zranb1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 12,390,881 - 12,439,746 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936486 13,135,740 - 13,170,462 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936486 13,135,759 - 13,170,462 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZRANB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 134,254,000 - 134,329,064 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 134,253,927 - 134,327,835 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 145,804,215 - 145,880,481 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZRANB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 117,561,468 - 117,634,226 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 117,561,226 - 117,631,817 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 78,918,277 - 78,989,747 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zranb1
.
Predicted Target Of
Count of predictions: 1237 Count of miRNA genes: 781 Interacting mature miRNAs: 890 Transcripts: ENST00000359653, ENST00000471421 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
597512476 GWAS1608550_H body mass index QTL GWAS1608550 (human) 1e-09 body mass index body mass index (BMI) (CMO:0000105) 10 124919170 124919171 Human 597025203 GWAS1121277_H blood urea nitrogen measurement QTL GWAS1121277 (human) 1e-08 blood urea nitrogen measurement blood urea nitrogen level (CMO:0000049) 10 124975597 124975598 Human 597407699 GWAS1503773_H body mass index QTL GWAS1503773 (human) 1e-09 body mass index body mass index (BMI) (CMO:0000105) 10 124941039 124941040 Human 597488118 GWAS1584192_H body weight QTL GWAS1584192 (human) 2e-16 body mass (VT:0001259) body weight (CMO:0000012) 10 124941039 124941040 Human 597503158 GWAS1599232_H age-related hearing impairment QTL GWAS1599232 (human) 1e-08 age-related hearing impairment 10 124938711 124938712 Human 597220051 GWAS1316125_H lung cancer QTL GWAS1316125 (human) 0.000001 lung cancer 10 124961380 124961381 Human 597229746 GWAS1325820_H age at menopause QTL GWAS1325820 (human) 1e-47 age at menopause 10 124969506 124969507 Human 597380564 GWAS1476638_H body mass index QTL GWAS1476638 (human) 8e-10 body mass index body mass index (BMI) (CMO:0000105) 10 124928251 124928252 Human 597466348 GWAS1562422_H creatine kinase measurement QTL GWAS1562422 (human) 4e-08 creatine kinase measurement blood creatine kinase activity level (CMO:0002242) 10 124922340 124922341 Human 597049765 GWAS1145839_H erythrocyte count QTL GWAS1145839 (human) 6e-13 erythrocyte count red blood cell count (CMO:0000025) 10 124969506 124969507 Human 597396142 GWAS1492216_H body mass index QTL GWAS1492216 (human) 6e-15 body mass index body mass index (BMI) (CMO:0000105) 10 124941039 124941040 Human 597059424 GWAS1155498_H age at menopause QTL GWAS1155498 (human) 4e-13 red blood cell density measurement 10 124969506 124969507 Human 597524298 GWAS1620372_H body mass index QTL GWAS1620372 (human) 4e-10 body mass index body mass index (BMI) (CMO:0000105) 10 124919170 124919171 Human 596953324 GWAS1072843_H red blood cell density measurement QTL GWAS1072843 (human) 1e-10 red blood cell density measurement 10 124969506 124969507 Human 597588549 GWAS1645409_H hematocrit QTL GWAS1645409 (human) 2e-12 hematocrit hematocrit (CMO:0000037) 10 124986120 124986121 Human 597469633 GWAS1565707_H appendicular lean mass QTL GWAS1565707 (human) 7e-17 appendicular lean mass 10 124923941 124923942 Human 596966218 GWAS1085737_H body mass index QTL GWAS1085737 (human) 6e-15 body mass index 10 124941039 124941040 Human
STS-H24463
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 126,675,651 - 126,675,898 UniSTS GRCh37 Build 36 10 126,665,641 - 126,665,888 RGD NCBI36 Celera 10 120,449,460 - 120,449,707 RGD Cytogenetic Map 10 q26.13 UniSTS HuRef 10 120,362,648 - 120,362,895 UniSTS GeneMap99-GB4 RH Map 10 548.52 UniSTS
SGC38118
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 126,639,845 - 126,640,105 UniSTS GRCh37 Build 36 10 126,629,835 - 126,630,095 RGD NCBI36 Celera 10 120,413,652 - 120,413,912 RGD Cytogenetic Map 10 q26.13 UniSTS HuRef 10 120,326,300 - 120,326,560 UniSTS GeneMap99-GB4 RH Map 10 547.73 UniSTS Whitehead-RH Map 10 654.8 UniSTS
SHGC-30414
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 126,675,104 - 126,675,253 UniSTS GRCh37 Build 36 10 126,665,094 - 126,665,243 RGD NCBI36 Celera 10 120,448,911 - 120,449,060 RGD Cytogenetic Map 10 q26.13 UniSTS HuRef 10 120,362,099 - 120,362,248 UniSTS Stanford-G3 RH Map 10 6045.0 UniSTS GeneMap99-GB4 RH Map 10 548.52 UniSTS Whitehead-RH Map 10 654.7 UniSTS NCBI RH Map 10 1358.5 UniSTS GeneMap99-G3 RH Map 10 6281.0 UniSTS
SHGC-36008
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 126,675,869 - 126,675,969 UniSTS GRCh37 Build 36 10 126,665,859 - 126,665,959 RGD NCBI36 Celera 10 120,449,678 - 120,449,778 RGD Cytogenetic Map 10 q26.13 UniSTS HuRef 10 120,362,866 - 120,362,966 UniSTS GeneMap99-G3 RH Map 10 6281.0 UniSTS
RH47020
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 126,674,826 - 126,675,001 UniSTS GRCh37 Build 36 10 126,664,816 - 126,664,991 RGD NCBI36 Celera 10 120,448,633 - 120,448,808 RGD Cytogenetic Map 10 q26.13 UniSTS HuRef 10 120,361,825 - 120,361,996 UniSTS GeneMap99-GB4 RH Map 10 547.83 UniSTS
SHGC-36286
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 126,674,059 - 126,674,162 UniSTS GRCh37 Build 36 10 126,664,049 - 126,664,152 RGD NCBI36 Celera 10 120,447,866 - 120,447,969 RGD Cytogenetic Map 10 q26.13 UniSTS HuRef 10 120,361,057 - 120,361,160 UniSTS GeneMap99-G3 RH Map 10 6272.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2432
2788
2245
4942
1723
2345
4
622
1948
464
2268
7281
6454
52
3708
847
1731
1612
170
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000359653 ⟹ ENSP00000352676
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 124,942,123 - 124,988,189 (+) Ensembl
Ensembl Acc Id:
ENST00000471421
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 124,981,411 - 124,983,496 (+) Ensembl
RefSeq Acc Id:
NM_017580 ⟹ NP_060050
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 124,942,123 - 124,988,189 (+) NCBI GRCh37 10 126,605,704 - 126,676,005 (+) NCBI Build 36 10 126,620,682 - 126,665,995 (+) NCBI Archive Celera 10 120,404,500 - 120,449,814 (+) RGD HuRef 10 120,317,070 - 120,363,002 (+) RGD CHM1_1 10 126,912,463 - 126,957,768 (+) NCBI T2T-CHM13v2.0 10 125,823,167 - 125,869,209 (+) NCBI
Sequence:
GTGATGGCCTCCCTGAAATTAAACATTTCTATTAGTGGCTTCCCGTTAATCTCATCCTTCTTAGATCAAACCTCGTTATATCTCCTGCCTATCTCTTTTGCATTCCAAAGTTCAGTTTTATTAAATCC
hide sequence
RefSeq Acc Id:
XM_006717907 ⟹ XP_006717970
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 124,916,894 - 124,988,189 (+) NCBI
Sequence:
TTGTTTTTTAAATCAGCCTGGACATTTAAATATATTGTGCCAGCATATTAGTTACATGAAGATT
hide sequence
RefSeq Acc Id:
XM_047425383 ⟹ XP_047281339
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 124,916,894 - 124,988,189 (+) NCBI
RefSeq Acc Id:
XM_047425384 ⟹ XP_047281340
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 124,917,513 - 124,988,189 (+) NCBI
RefSeq Acc Id:
XM_047425385 ⟹ XP_047281341
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 124,927,250 - 124,988,189 (+) NCBI
RefSeq Acc Id:
XR_007061968
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 124,933,396 - 124,981,794 (+) NCBI
RefSeq Acc Id:
NP_060050 ⟸ NM_017580
- UniProtKB:
Q5SQP6 (UniProtKB/Swiss-Prot), D3DRF4 (UniProtKB/Swiss-Prot), B4DZ98 (UniProtKB/Swiss-Prot), Q69YK3 (UniProtKB/Swiss-Prot), Q9UGI0 (UniProtKB/Swiss-Prot)
- Sequence:
MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPRAIRCTQCLSQRRTRSPTESPQSSGSGSR
hide sequence
RefSeq Acc Id:
XP_006717970 ⟸ XM_006717907
- Peptide Label:
isoform X1
- Sequence:
MCKVEVIAWELKSYFLPDTAHFKKCTMSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPRAI
hide sequence
Ensembl Acc Id:
ENSP00000352676 ⟸ ENST00000359653
RefSeq Acc Id:
XP_047281339 ⟸ XM_047425383
- Peptide Label:
isoform X2
- UniProtKB:
Q9UGI0 (UniProtKB/Swiss-Prot), Q5SQP6 (UniProtKB/Swiss-Prot), D3DRF4 (UniProtKB/Swiss-Prot), B4DZ98 (UniProtKB/Swiss-Prot), Q69YK3 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047281340 ⟸ XM_047425384
- Peptide Label:
isoform X2
- UniProtKB:
Q9UGI0 (UniProtKB/Swiss-Prot), Q5SQP6 (UniProtKB/Swiss-Prot), D3DRF4 (UniProtKB/Swiss-Prot), B4DZ98 (UniProtKB/Swiss-Prot), Q69YK3 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047281341 ⟸ XM_047425385
- Peptide Label:
isoform X2
- UniProtKB:
Q9UGI0 (UniProtKB/Swiss-Prot), Q5SQP6 (UniProtKB/Swiss-Prot), D3DRF4 (UniProtKB/Swiss-Prot), B4DZ98 (UniProtKB/Swiss-Prot), Q69YK3 (UniProtKB/Swiss-Prot)
RGD ID: 7218949 Promoter ID: EPDNEW_H15221 Type: initiation region Name: ZRANB1_1 Description: zinc finger RANBP2-type containing 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 10 124,917,172 - 124,917,232 EPDNEW
RGD ID: 6788406 Promoter ID: HG_KWN:11565 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid Transcripts: OTTHUMT00000050898 Position: Human Assembly Chr Position (strand) Source Build 36 10 126,621,114 - 126,621,614 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-16
ZRANB1
zinc finger RANBP2-type containing 1
zinc finger, RAN-binding domain containing 1
Symbol and/or name change
5135510 APPROVED
