Advanced Search (OLGA)

Gene: CTSG (cathepsin G) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

CTSG

Name:

cathepsin G

RGD ID:

1317010

HGNC Page

HGNC:2532

Description:

Enables several functions, including caspase binding activity; heparin binding activity; and serine-type endopeptidase activity. Involved in several processes, including biofilm matrix disassembly; defense response to bacterium; and regulation of cell-cell adhesion. Acts upstream of or within proteolysis. Located in several cellular components, including cytoplasmic stress granule; lysosome; and secretory granule.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

CATG; CG; MGC23078

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Ctsg (cathepsin G)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Ctsg (cathepsin G)	HGNC	EggNOG, Ensembl, HomoloGene, OrthoDB, Treefam
Pan paniscus (bonobo/pygmy chimpanzee):	CTSG (cathepsin G)	NCBI	Ortholog
Canis lupus familiaris (dog):	CTSG (cathepsin G)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Sus scrofa (pig):	LOC100154047 (cathepsin G)	HGNC	Ensembl, OrthoDB
Chlorocebus sabaeus (green monkey):	CTSG (cathepsin G)	NCBI	Ortholog
Other homologs ²
Canis lupus familiaris (dog):	GZMB (granzyme B)	HGNC	EggNOG, Panther
Rattus norvegicus (Norway rat):	Mcpt9 (mast cell protease 9)	HGNC	Treefam
Mus musculus (house mouse):	Mcpt8 (mast cell protease 8)	HGNC	Treefam
Rattus norvegicus (Norway rat):	Mtss2 (MTSS I-BAR domain containing 2)	HGNC	OMA
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Ctsg (cathepsin G)	Alliance	DIOPT (HGNC\|PhylomeDB)
Mus musculus (house mouse):	Ctsg (cathepsin G)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gzm3 (granzyme 3, tandem duplicate 1)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	gzm3.3	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	gzm3.4	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	gzm3.2	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gzmh	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	ctsg	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,573,518 - 24,576,250 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,573,518 - 24,576,250 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	25,042,724 - 25,045,456 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	24,112,564 - 24,115,306 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	24,112,563 - 24,115,306	NCBI
Celera	14	4,907,510 - 4,910,252 (-)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	5,157,531 - 5,160,273 (-)	NCBI		HuRef
CHM1_1	14	25,041,620 - 25,044,362 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,772,405 - 18,775,137 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CTSG	Human	Reperfusion Injury		ISO	Ctsg (Mus musculus)	7242055		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CTSG	Human	Brain-Lung-Thyroid Syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Brain-lung-thyroid syndrome	ClinVar	PMID:25741868
CTSG	Human	lysinuric protein intolerance		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Lysinuric protein intolerance	ClinVar	PMID:28492532
CTSG	Human	Specific Granule Deficiency		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Specific granule deficiency	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CTSG	Human	(-)-alpha-phellandrene	decreases expression	EXP		6480464	alpha phellandrene results in decreased expression of CTSG mRNA	CTD	PMID:25075043
CTSG	Human	(-)-trans-epsilon-viniferin	multiple interactions	EXP		6480464	epsilon-viniferin inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein]	CTD	PMID:34144024
CTSG	Human	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	EXP		6480464	2 more ...	CTD	PMID:31675489
CTSG	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Ctsg (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of CTSG mRNA	CTD	PMID:16114106
CTSG	Human	2,4,6-tribromophenol	decreases expression	EXP		6480464	2 more ...	CTD	PMID:31675489
CTSG	Human	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Ctsg (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
CTSG	Human	3,3',5,5'-tetrabromobisphenol A	decreases expression	EXP		6480464	tetrabromobisphenol A results in decreased expression of CTSG protein	CTD	PMID:31675489
CTSG	Human	4,4'-sulfonyldiphenol	decreases expression	ISO	Ctsg (Mus musculus)	6480464	bisphenol S results in decreased expression of CTSG mRNA	CTD	PMID:39298647
CTSG	Human	aflatoxin B1	increases expression	ISO	Ctsg (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of CTSG mRNA	CTD	PMID:19770486
CTSG	Human	all-trans-retinoic acid	decreases expression	ISO	Ctsg (Mus musculus)	6480464	Tretinoin results in decreased expression of CTSG mRNA	CTD	PMID:16604517
CTSG	Human	all-trans-retinoic acid	multiple interactions	EXP		6480464	[Tretinoin co-treated with arsenic trioxide] results in decreased expression of CTSG mRNA	CTD	PMID:15894607
CTSG	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of CTSG mRNA	CTD	PMID:15894607 and PMID:17218384
CTSG	Human	alpha-phellandrene	decreases expression	EXP		6480464	alpha phellandrene results in decreased expression of CTSG mRNA	CTD	PMID:25075043
CTSG	Human	anilines	increases hydrolysis	EXP		6480464	CTSG protein results in increased hydrolysis of Aniline Compounds analog	CTD	PMID:6566611
CTSG	Human	anilines	increases hydrolysis	ISO	Ctsg (Rattus norvegicus)	6480464	CTSG protein results in increased hydrolysis of Aniline Compounds analog	CTD	PMID:6566611
CTSG	Human	arsane	multiple interactions	EXP		6480464	[Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of CTSG mRNA	CTD	PMID:28793237
CTSG	Human	arsane	affects expression	EXP		6480464	Arsenic affects the expression of CTSG mRNA	CTD	PMID:28793237
CTSG	Human	arsenic atom	multiple interactions	EXP		6480464	[Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of CTSG mRNA	CTD	PMID:28793237
CTSG	Human	arsenic atom	affects expression	EXP		6480464	Arsenic affects the expression of CTSG mRNA	CTD	PMID:28793237
CTSG	Human	arsenous acid	multiple interactions	EXP		6480464	[Tretinoin co-treated with Arsenic Trioxide] results in decreased expression of CTSG mRNA	CTD	PMID:15894607
CTSG	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of CTSG promoter	CTD	PMID:27901495
CTSG	Human	bisphenol A	increases expression	ISO	Ctsg (Mus musculus)	6480464	bisphenol A results in increased expression of CTSG mRNA	CTD	PMID:26063408
CTSG	Human	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CTSG protein	CTD	PMID:31675489
CTSG	Human	bisphenol A	decreases expression	ISO	Ctsg (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of CTSG mRNA	CTD	PMID:25181051
CTSG	Human	cannabidiol	increases expression	ISO	Ctsg (Mus musculus)	6480464	Cannabidiol results in increased expression of CTSG mRNA	CTD	PMID:21542829
CTSG	Human	chlorpyrifos	increases expression	ISO	Ctsg (Mus musculus)	6480464	Chlorpyrifos results in increased expression of CTSG mRNA	CTD	PMID:32715474
CTSG	Human	corn oil	increases expression	ISO	Ctsg (Rattus norvegicus)	6480464	Corn Oil results in increased expression of CTSG mRNA	CTD	PMID:22760963
CTSG	Human	Cyclosporin H	multiple interactions	EXP		6480464	cyclosporin H inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein]	CTD	PMID:34144024
CTSG	Human	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of CTSG protein	CTD	PMID:31675489
CTSG	Human	diarsenic trioxide	multiple interactions	EXP		6480464	[Tretinoin co-treated with Arsenic Trioxide] results in decreased expression of CTSG mRNA	CTD	PMID:15894607
CTSG	Human	dimethylarsinic acid	multiple interactions	EXP		6480464	[Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of CTSG mRNA	CTD	PMID:28793237
CTSG	Human	doxorubicin	affects response to substance	EXP		6480464	CTSG affects the susceptibility to Doxorubicin	CTD	PMID:16458935
CTSG	Human	genistein	decreases expression	ISO	Ctsg (Mus musculus)	6480464	Genistein results in decreased expression of CTSG mRNA	CTD	PMID:32186404
CTSG	Human	Honokiol	multiple interactions	EXP		6480464	honokiol inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein]	CTD	PMID:25980585
CTSG	Human	methotrexate	decreases expression	EXP		6480464	Methotrexate results in decreased expression of CTSG mRNA	CTD	PMID:17400583
CTSG	Human	methotrexate	increases expression	EXP		6480464	Methotrexate results in increased expression of CTSG mRNA	CTD	PMID:24449571
CTSG	Human	N-formyl-L-methionyl-L-leucyl-L-phenylalanine	increases secretion	EXP		6480464	N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein	CTD	PMID:25980585 and PMID:34144024
CTSG	Human	N-formyl-L-methionyl-L-leucyl-L-phenylalanine	multiple interactions	EXP		6480464	cyclosporin H inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein] more ...	CTD	PMID:25980585 and PMID:34144024
CTSG	Human	paracetamol	affects expression	ISO	Ctsg (Mus musculus)	6480464	Acetaminophen affects the expression of CTSG mRNA	CTD	PMID:17562736
CTSG	Human	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of CTSG mRNA	CTD	PMID:26690555
CTSG	Human	perfluorohexanesulfonic acid	increases expression	ISO	Ctsg (Mus musculus)	6480464	perfluorohexanesulfonic acid results in increased expression of CTSG mRNA	CTD	PMID:37995155
CTSG	Human	phorbol 13-acetate 12-myristate	increases secretion	EXP		6480464	Tetradecanoylphorbol Acetate results in increased secretion of CTSG protein	CTD	PMID:25980585 and PMID:34144024
CTSG	Human	phorbol 13-acetate 12-myristate	affects localization	EXP		6480464	Tetradecanoylphorbol Acetate affects the localization of CTSG protein	CTD	PMID:25980585
CTSG	Human	potassium dichromate	increases expression	ISO	Ctsg (Mus musculus)	6480464	Potassium Dichromate results in increased expression of CTSG mRNA	CTD	PMID:23608068
CTSG	Human	senecionine	increases expression	ISO	Ctsg (Mus musculus)	6480464	senecionine results in increased expression of CTSG protein	CTD	PMID:35357534
CTSG	Human	sulforaphane	decreases expression	EXP		6480464	sulforaphane results in decreased expression of CTSG mRNA	CTD	PMID:26833863
CTSG	Human	vanadyl sulfate	increases expression	EXP		6480464	vanadyl sulfate results in increased expression of CTSG mRNA	CTD	PMID:16330358

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CTSG	Human	angiotensin maturation	involved_in	TAS		150520179		Reactome	Reactome:R-HSA-2022411
CTSG	Human	biofilm matrix disassembly	involved_in	IDA		150520179	PMID:32995850	UniProt	PMID:32995850
CTSG	Human	chemotaxis	involved_in	IEA	UniProtKB-KW:KW-0145	150520179		UniProt	GO_REF:0000043
CTSG	Human	cytokine-mediated signaling pathway	involved_in	TAS		150520179		Reactome	Reactome:R-HSA-446652
CTSG	Human	defense response to bacterium	involved_in	IEA	UniProtKB-KW:KW-0044	150520179		UniProt	GO_REF:0000043
CTSG	Human	defense response to fungus	acts_upstream_of_or_within	IEA	UniProtKB:P28293 and ensembl:ENSMUSP00000015583	150520179		Ensembl	GO_REF:0000107
CTSG	Human	defense response to Gram-negative bacterium	involved_in	IDA		150520179	PMID:2116408	UniProt	PMID:2116408
CTSG	Human	defense response to Gram-positive bacterium	involved_in	IDA		150520179	PMID:2116408 and PMID:2117044	UniProt	PMID:2116408 and PMID:2117044
CTSG	Human	defense response to Gram-positive bacterium	acts_upstream_of_or_within	IEA	UniProtKB:P28293 and ensembl:ENSMUSP00000015583	150520179		Ensembl	GO_REF:0000107
CTSG	Human	extracellular matrix disassembly	involved_in	TAS		150520179		Reactome	Reactome:R-HSA-1474228
CTSG	Human	immune response	involved_in	TAS		150520179	PMID:2569462	PINC	PMID:2569462
CTSG	Human	monocyte chemotaxis	involved_in	IDA		150520179	PMID:15210802	UniProt	PMID:15210802
CTSG	Human	negative regulation of T cell activation	involved_in	IDA		150520179	PMID:15100291	UniProt	PMID:15100291
CTSG	Human	neutrophil activation	involved_in	IDA		150520179	PMID:22879591	UniProt	PMID:22879591
CTSG	Human	neutrophil-mediated killing of gram-positive bacterium	acts_upstream_of_or_within	IEA	UniProtKB:P28293 and ensembl:ENSMUSP00000015583	150520179		Ensembl	GO_REF:0000107
CTSG	Human	platelet activation	involved_in	IDA		150520179	PMID:10702240	UniProt	PMID:10702240
CTSG	Human	positive regulation of immune response	acts_upstream_of_or_within	IEA	UniProtKB:P28293 and ensembl:ENSMUSP00000015583	150520179		Ensembl	GO_REF:0000107
CTSG	Human	positive regulation of platelet aggregation	involved_in	IDA		150520179	PMID:3390156	UniProt	PMID:3390156
CTSG	Human	protein maturation	involved_in	IBA	MGI:109267 more ...	150520179		GO_Central	GO_REF:0000033
CTSG	Human	protein phosphorylation	involved_in	IDA		150520179	PMID:8573071	CACAO	PMID:8573071
CTSG	Human	protein processing	involved_in	IDA		150520179	PMID:16963625 more ...	UniProt	PMID:16963625 more ...
CTSG	Human	proteolysis	involved_in	IDA		150520179	PMID:11259672 more ...	UniProt	PMID:11259672 more ...
CTSG	Human	proteolysis	involved_in	IEA	InterPro:IPR001254 and InterPro:IPR018114	150520179		InterPro	GO_REF:0000002
CTSG	Human	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	150520179		UniProt	GO_REF:0000043
CTSG	Human	proteolysis	acts_upstream_of_or_within	IDA		150520179	PMID:11907569	MGI	PMID:11907569
CTSG	Human	purinergic nucleotide receptor signaling pathway	involved_in	TAS		150520179		Reactome	Reactome:R-HSA-9660826
CTSG	Human	response to lipopolysaccharide	acts_upstream_of_or_within	IEA	UniProtKB:P28293 and ensembl:ENSMUSP00000015583	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CTSG	Human	azurophil granule lumen	located_in	TAS		150520179		Reactome	Reactome:R-HSA-6798751
CTSG	Human	collagen-containing extracellular matrix	located_in	HDA		150520179	PMID:20551380 more ...	BHF-UCL	PMID:20551380 more ...
CTSG	Human	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	150520179		UniProt	GO_REF:0000043
CTSG	Human	cytoplasmic stress granule	located_in	IDA		150520179	PMID:1937776	UniProt	PMID:1937776
CTSG	Human	cytosol	located_in	IDA		150520179	PMID:29077095	UniProt	PMID:29077095
CTSG	Human	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	150520179		UniProt	GO_REF:0000044
CTSG	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-448678 and Reactome:R-HSA-9635424
CTSG	Human	extracellular exosome	located_in	HDA		150520179	PMID:19056867 and PMID:23533145	UniProt	PMID:19056867 and PMID:23533145
CTSG	Human	extracellular region	located_in	HDA		150520179	PMID:27068509	BHF-UCL	PMID:27068509
CTSG	Human	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
CTSG	Human	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
CTSG	Human	extracellular region	located_in	TAS		150520179		Reactome	Reactome:R-HSA-1592316 more ...
CTSG	Human	extracellular space	located_in	IDA		150520179	PMID:29077095 more ...	UniProt	PMID:29077095 more ...
CTSG	Human	extracellular space	located_in	HDA		150520179	PMID:20551380	BHF-UCL	PMID:20551380
CTSG	Human	extracellular space	is_active_in	IBA	MGI:109266 more ...	150520179		GO_Central	GO_REF:0000033
CTSG	Human	lysosome	located_in	IEA	UniProtKB-SubCell:SL-0158	150520179		UniProt	GO_REF:0000044
CTSG	Human	lysosome	located_in	IEA	UniProtKB-KW:KW-0458	150520179		UniProt	GO_REF:0000043
CTSG	Human	lysosome	located_in	IDA		150520179	PMID:15100291	UniProt	PMID:15100291
CTSG	Human	membrane	located_in	IDA		150520179	PMID:29077095	UniProt	PMID:29077095
CTSG	Human	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
CTSG	Human	nucleus	located_in	IDA		150520179	PMID:11259672	UniProt	PMID:11259672
CTSG	Human	nucleus	located_in	HDA		150520179	PMID:21630459	UniProt	PMID:21630459
CTSG	Human	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
CTSG	Human	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
CTSG	Human	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	150520179		UniProt	GO_REF:0000044
CTSG	Human	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	150520179		UniProt	GO_REF:0000043
CTSG	Human	plasma membrane	located_in	IDA		150520179	PMID:1861080	UniProt	PMID:1861080
CTSG	Human	plasma membrane	located_in	TAS		150520179		Reactome	Reactome:R-HSA-2022411 more ...
CTSG	Human	secretory granule	located_in	IDA		150520179	PMID:11907569	MGI	PMID:11907569

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CTSG	Human	caspase binding	enables	IPI	UniProtKB:P49662	150520179	PMID:29077095	UniProt	PMID:29077095
CTSG	Human	heparin binding	enables	IDA		150520179	PMID:11907569	MGI	PMID:11907569
CTSG	Human	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	150520179		UniProt	GO_REF:0000043
CTSG	Human	peptidase activity	enables	TAS		150520179		Reactome	Reactome:R-HSA-448678
CTSG	Human	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	150520179		UniProt	GO_REF:0000043
CTSG	Human	peptidase activity	enables	IDA		150520179	PMID:11907569	MGI	PMID:11907569
CTSG	Human	protein binding	enables	IPI	UniProtKB:Q15323 and UniProtKB:Q7Z3S9	150520179	PMID:25416956	IntAct	PMID:25416956
CTSG	Human	protein binding	enables	IPI	UniProtKB:A8MQ03 and UniProtKB:Q9NRD5	150520179	PMID:32296183	IntAct	PMID:32296183
CTSG	Human	receptor ligand activity	enables	IDA		150520179	PMID:15210802	UniProt	PMID:15210802
CTSG	Human	serine-type endopeptidase activity	enables	IBA	MGI:109267 more ...	150520179		GO_Central	GO_REF:0000033
CTSG	Human	serine-type endopeptidase activity	enables	IEA	InterPro:IPR001254 and InterPro:IPR018114	150520179		InterPro	GO_REF:0000002
CTSG	Human	serine-type endopeptidase activity	enables	IDA		150520179	PMID:12504904 more ...	UniProt	PMID:12504904 more ...
CTSG	Human	serine-type endopeptidase activity	enables	EXP		150520179	PMID:10512690	Reactome	PMID:10512690
CTSG	Human	serine-type endopeptidase activity	enables	TAS		150520179		Reactome	Reactome:R-HSA-3785684
CTSG	Human	serine-type endopeptidase activity	enables	IEA	EC:3.4.21.20	150520179		UniProt	GO_REF:0000003
CTSG	Human	serine-type peptidase activity	enables	IMP		150520179	PMID:1937776	UniProt	PMID:1937776
CTSG	Human	serine-type peptidase activity	enables	IEA	UniProtKB-KW:KW-0720	150520179		UniProt	GO_REF:0000043

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CTSG	Human	Entamoebiasis pathway		IEA		6907045		KEGG	hsa:05146
CTSG	Human	renin-angiotensin cascade pathway		IEA		6907045		KEGG	hsa:04614
CTSG	Human	systemic lupus erythematosus pathway		IEA		6907045		KEGG	hsa:05322

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Cathepsin g is required for sustained inflammation and tissue injury after reperfusion of ischemic kidneys.	Shimoda N, etal., Am J Pathol. 2007 Mar;170(3):930-40.

PMID:1387511	PMID:1452887	PMID:1861080	PMID:1873479	PMID:1937776	PMID:2116408	PMID:2117044	PMID:2164060	PMID:2318847	PMID:2501794	PMID:2569462	PMID:2616953
PMID:2681419	PMID:3304423	PMID:3390156	PMID:3799965	PMID:3911778	PMID:6294088	PMID:7517206	PMID:7593196	PMID:7744748	PMID:7936190	PMID:8090757	PMID:8125298
PMID:8194606	PMID:8400294	PMID:8408036	PMID:8454293	PMID:8573071	PMID:8849841	PMID:8896442	PMID:9337538	PMID:9412840	PMID:9536127	PMID:9565572	PMID:9698370
PMID:9718313	PMID:10512690	PMID:10702240	PMID:10899625	PMID:10978167	PMID:11241273	PMID:11259672	PMID:11307827	PMID:11389039	PMID:11502364	PMID:11520773	PMID:11520793
PMID:11536009	PMID:11557685	PMID:11747312	PMID:11907569	PMID:11920276	PMID:11928814	PMID:11945165	PMID:11961105	PMID:11986950	PMID:12189154	PMID:12477932	PMID:12504904
PMID:12524437	PMID:12531874	PMID:12784398	PMID:12949073	PMID:14688365	PMID:14737102	PMID:15100291	PMID:15123239	PMID:15131125	PMID:15140022	PMID:15210802	PMID:15385470
PMID:15489334	PMID:15650747	PMID:15967795	PMID:16034099	PMID:16317101	PMID:16444434	PMID:16963625	PMID:16977463	PMID:17418861	PMID:17653609	PMID:18217133	PMID:18586676
PMID:18835135	PMID:19036358	PMID:19056482	PMID:19056867	PMID:19250736	PMID:19528350	PMID:19578796	PMID:19620298	PMID:19910052	PMID:19913121	PMID:20056178	PMID:20331476
PMID:20551380	PMID:20589323	PMID:20628086	PMID:20800603	PMID:21193413	PMID:21488974	PMID:21543057	PMID:21630459	PMID:21850236	PMID:21873635	PMID:22145905	PMID:22588119
PMID:22641217	PMID:22879591	PMID:22915586	PMID:23147993	PMID:23376485	PMID:23454598	PMID:23466190	PMID:23533145	PMID:23940756	PMID:24532668	PMID:24877096	PMID:24929239
PMID:25037231	PMID:25248056	PMID:25416956	PMID:26186194	PMID:26270939	PMID:26837514	PMID:26986619	PMID:27068509	PMID:27559042	PMID:27666013	PMID:28053237	PMID:28344315
PMID:28514442	PMID:28544544	PMID:28675934	PMID:28797985	PMID:29077095	PMID:29478914	PMID:29703634	PMID:29976772	PMID:30017196	PMID:30791695	PMID:30804664	PMID:30824926
PMID:31647805	PMID:32144329	PMID:32194574	PMID:32203420	PMID:32296183	PMID:32303641	PMID:32707033	PMID:32813288	PMID:32995850	PMID:33132312	PMID:33245176	PMID:33961781
PMID:34376113	PMID:35462067	PMID:35833506	PMID:37151875	PMID:38362707	PMID:38677729	PMID:39147351	PMID:39357873

CTSG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,573,518 - 24,576,250 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,573,518 - 24,576,250 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	25,042,724 - 25,045,456 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	24,112,564 - 24,115,306 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	24,112,563 - 24,115,306	NCBI
Celera	14	4,907,510 - 4,910,252 (-)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	5,157,531 - 5,160,273 (-)	NCBI		HuRef
CHM1_1	14	25,041,620 - 25,044,362 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,772,405 - 18,775,137 (-)	NCBI		T2T-CHM13v2.0

Ctsg
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	56,337,342 - 56,340,031 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	56,337,338 - 56,340,031 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	56,099,885 - 56,102,574 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	56,099,881 - 56,102,574 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	56,718,718 - 56,721,411 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	55,053,952 - 55,056,645 (-)	NCBI		MGSCv36	mm8
Celera	14	53,905,080 - 53,907,773 (-)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

Ctsg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,901,230 - 33,907,596 (-)	NCBI		GRCr8
mRatBN7.2	15	29,930,988 - 29,937,353 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,931,003 - 29,937,353 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	31,780,745 - 31,783,332 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,927,946 - 32,930,533 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	31,186,079 - 31,188,666 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	35,107,333 - 35,113,678 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	35,111,091 - 35,113,678 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,994,558 - 39,000,903 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	34,622,211 - 34,624,798 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	34,637,918 - 34,648,441 (-)	NCBI
Celera	15	29,509,460 - 29,512,047 (-)	NCBI		Celera
Cytogenetic Map	15	p12	NCBI

CTSG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	25,921,107 - 25,923,838 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	25,137,599 - 25,140,330 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	5,342,517 - 5,345,218 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	23,466,259 - 23,468,960 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	23,466,265 - 23,468,960 (-)	Ensembl	panpan1.1		panPan2

CTSG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,483,327 - 4,485,933 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,470,577 - 4,512,628 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,404,974 - 4,407,573 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,594,740 - 4,597,337 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,582,079 - 4,597,280 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	4,284,216 - 4,286,825 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	4,346,800 - 4,349,397 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,609,195 - 4,611,806 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100154047
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	7	74,761,602 - 74,772,950 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	79,789,517 - 79,792,248 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CTSG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,518,004 - 1,521,980 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	1,518,119 - 1,520,709 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666036	13,210,626 - 13,213,332 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in CTSG
23 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 14q11.2-12(chr14:20151149-27723796)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051484]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051484]\|See cases [RCV000051484]	Chr14:20151149..27723796 [GRCh38] Chr14:20619308..28193002 [GRCh37] Chr14:19689148..27262842 [NCBI36] Chr14:14q11.2-12	pathogenic
GRCh38/hg38 14q11.2-21.2(chr14:20196945-45284802)x1	copy number loss	See cases [RCV000051485]	Chr14:20196945..45284802 [GRCh38] Chr14:20665104..45754005 [GRCh37] Chr14:19734944..44823755 [NCBI36] Chr14:14q11.2-21.2	pathogenic
GRCh38/hg38 14q11.2-21.1(chr14:23548960-41983402)x1	copy number loss	See cases [RCV000051490]	Chr14:23548960..41983402 [GRCh38] Chr14:24018169..42452605 [GRCh37] Chr14:23088009..41522355 [NCBI36] Chr14:14q11.2-21.1	pathogenic
GRCh38/hg38 14q11.2-21.1(chr14:20000611-38984415)x3	copy number gain	See cases [RCV000053803]	Chr14:20000611..38984415 [GRCh38] Chr14:20468770..39453619 [GRCh37] Chr14:19538610..38523370 [NCBI36] Chr14:14q11.2-21.1	pathogenic
GRCh38/hg38 14q11.2-21.1(chr14:20150949-39746154)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053806]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053806]\|See cases [RCV000053806]	Chr14:20150949..39746154 [GRCh38] Chr14:20619108..40215358 [GRCh37] Chr14:19688948..39285109 [NCBI36] Chr14:14q11.2-21.1	pathogenic
NM_001911.2(CTSG):c.668T>C (p.Val223Ala)	single nucleotide variant	Malignant melanoma [RCV000070520]	Chr14:24573737 [GRCh38] Chr14:25042943 [GRCh37] Chr14:24112783 [NCBI36] Chr14:14q12	not provided
GRCh38/hg38 14q11.2-32.33(chr14:20151149-106855263)x3	copy number gain	See cases [RCV000135543]	Chr14:20151149..106855263 [GRCh38] Chr14:20619308..107263478 [GRCh37] Chr14:19689148..106334523 [NCBI36] Chr14:14q11.2-32.33	pathogenic
GRCh38/hg38 14q11.2-12(chr14:20412587-25018120)x3	copy number gain	See cases [RCV000137725]	Chr14:20412587..25018120 [GRCh38] Chr14:20880746..25487326 [GRCh37] Chr14:19950586..24557166 [NCBI36] Chr14:14q11.2-12	likely pathogenic
GRCh38/hg38 14q11.2-12(chr14:23984065-25374494)x1	copy number loss	See cases [RCV000142873]	Chr14:23984065..25374494 [GRCh38] Chr14:24453274..25843700 [GRCh37] Chr14:23523114..24913540 [NCBI36] Chr14:14q11.2-12	pathogenic
GRCh38/hg38 14q11.2-32.33(chr14:20043514-106877229)x3	copy number gain	See cases [RCV000143373]	Chr14:20043514..106877229 [GRCh38] Chr14:20511673..107285437 [GRCh37] Chr14:19581513..106356482 [NCBI36] Chr14:14q11.2-32.33	pathogenic
GRCh38/hg38 14q11.2-21.2(chr14:20022693-44093672)x3	copy number gain	See cases [RCV000143186]	Chr14:20022693..44093672 [GRCh38] Chr14:20490852..44562875 [GRCh37] Chr14:19560692..43632625 [NCBI36] Chr14:14q11.2-21.2	pathogenic
GRCh38/hg38 14q11.2-21.3(chr14:20043513-48642042)x3	copy number gain	See cases [RCV000143748]	Chr14:20043513..48642042 [GRCh38] Chr14:20511672..49111245 [GRCh37] Chr14:19581512..48180995 [NCBI36] Chr14:14q11.2-21.3	pathogenic
GRCh37/hg19 14q11.2-12(chr14:19100682-28730087)	copy number gain	not provided [RCV000767822]	Chr14:19100682..28730087 [GRCh37] Chr14:14q11.2-12	pathogenic
GRCh37/hg19 14q11.2-12(chr14:19794561-27768254)x3	copy number gain	See cases [RCV000240285]	Chr14:19794561..27768254 [GRCh37] Chr14:14q11.2-12	pathogenic
GRCh37/hg19 14q11.2-22.2(chr14:23164384-54733411)x3	copy number gain	See cases [RCV000447658]	Chr14:23164384..54733411 [GRCh37] Chr14:14q11.2-22.2	pathogenic
GRCh37/hg19 14q11.2-32.33(chr14:19794561-107234280)x3	copy number gain	See cases [RCV000446256]	Chr14:19794561..107234280 [GRCh37] Chr14:14q11.2-32.33	pathogenic
GRCh37/hg19 14q11.2-13.1(chr14:19794561-34049214)x3	copy number gain	See cases [RCV000448273]	Chr14:19794561..34049214 [GRCh37] Chr14:14q11.2-13.1	pathogenic
NM_001911.3(CTSG):c.374A>G (p.Asn125Ser)	single nucleotide variant	not provided [RCV004716470]\|not specified [RCV000455949]	Chr14:24574465 [GRCh38] Chr14:25043671 [GRCh37] Chr14:14q12	benign
GRCh37/hg19 14q11.2-12(chr14:24233721-31377083)x1	copy number loss	See cases [RCV000510673]	Chr14:24233721..31377083 [GRCh37] Chr14:14q11.2-12	pathogenic
GRCh37/hg19 14q12(chr14:24917041-25611546)x3	copy number gain	See cases [RCV000510160]	Chr14:24917041..25611546 [GRCh37] Chr14:14q12	uncertain significance
GRCh37/hg19 14q11.2-32.33(chr14:20511673-107285437)	copy number gain	See cases [RCV000512041]	Chr14:20511673..107285437 [GRCh37] Chr14:14q11.2-32.33	pathogenic
NM_001911.3(CTSG):c.461G>A (p.Arg154Lys)	single nucleotide variant	not specified [RCV004314927]	Chr14:24574378 [GRCh38] Chr14:25043584 [GRCh37] Chr14:14q12	uncertain significance
GRCh37/hg19 14q11.1-32.33(chr14:19000422-107289053)x3	copy number gain	not provided [RCV000738412]	Chr14:19000422..107289053 [GRCh37] Chr14:14q11.1-32.33	pathogenic
GRCh37/hg19 14q11.2-32.33(chr14:19280733-107287663)x3	copy number gain	not provided [RCV000738413]	Chr14:19280733..107287663 [GRCh37] Chr14:14q11.2-32.33	pathogenic
GRCh37/hg19 14q11.2-32.33(chr14:19327823-107287663)x3	copy number gain	not provided [RCV000738414]	Chr14:19327823..107287663 [GRCh37] Chr14:14q11.2-32.33	pathogenic
NM_001911.3(CTSG):c.528C>T (p.Phe176=)	single nucleotide variant	not provided [RCV000965265]	Chr14:24574311 [GRCh38] Chr14:25043517 [GRCh37] Chr14:14q12	benign
NC_000014.8:g.(?_23242819)_(25103366_?)dup	duplication	Lysinuric protein intolerance [RCV003105428]\|Specific granule deficiency [RCV003105427]	Chr14:23242819..25103366 [GRCh37] Chr14:14q11.2-12	uncertain significance
NM_001911.3(CTSG):c.44G>C (p.Gly15Ala)	single nucleotide variant	not provided [RCV000957206]	Chr14:24576180 [GRCh38] Chr14:25045386 [GRCh37] Chr14:14q12	benign
NM_001911.3(CTSG):c.269C>T (p.Thr90Ile)	single nucleotide variant	not provided [RCV000957205]	Chr14:24574745 [GRCh38] Chr14:25043951 [GRCh37] Chr14:14q12	benign
GRCh37/hg19 14q11.2-21.2(chr14:20511672-44829030)x3	copy number gain	not provided [RCV001006605]	Chr14:20511672..44829030 [GRCh37] Chr14:14q11.2-21.2	pathogenic
GRCh37/hg19 14q11.2-21.1(chr14:20511672-42881888)x3	copy number gain	not provided [RCV001249358]	Chr14:20511672..42881888 [GRCh37] Chr14:14q11.2-21.1	not provided
GRCh37/hg19 14q11.2-21.3(chr14:20511672-47481203)	copy number gain	Seizure [RCV002280625]	Chr14:20511672..47481203 [GRCh37] Chr14:14q11.2-21.3	pathogenic
NC_000014.8:g.(21162263_36986276)_(36987308_50713602)del	deletion	Brain-lung-thyroid syndrome [RCV002221171]	Chr14:36986276..36987308 [GRCh37] Chr14:14q11.2-21.3	pathogenic
NM_001911.3(CTSG):c.336G>T (p.Leu112Phe)	single nucleotide variant	not specified [RCV004079317]	Chr14:24574678 [GRCh38] Chr14:25043884 [GRCh37] Chr14:14q12	uncertain significance
GRCh37/hg19 14q12-13.1(chr14:24959823-33415359)x1	copy number loss	not provided [RCV002475721]	Chr14:24959823..33415359 [GRCh37] Chr14:14q12-13.1	pathogenic
NM_001911.3(CTSG):c.751A>G (p.Met251Val)	single nucleotide variant	not specified [RCV004219676]	Chr14:24573654 [GRCh38] Chr14:25042860 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.91T>G (p.Ser31Ala)	single nucleotide variant	not specified [RCV004157025]	Chr14:24575377 [GRCh38] Chr14:25044583 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.58G>A (p.Glu20Lys)	single nucleotide variant	not specified [RCV004096986]	Chr14:24575410 [GRCh38] Chr14:25044616 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.758C>G (p.Thr253Ser)	single nucleotide variant	not specified [RCV004210947]	Chr14:24573647 [GRCh38] Chr14:25042853 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.626A>G (p.Asn209Ser)	single nucleotide variant	not specified [RCV004166716]	Chr14:24573779 [GRCh38] Chr14:25042985 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.463G>C (p.Gly155Arg)	single nucleotide variant	not specified [RCV004287496]	Chr14:24574376 [GRCh38] Chr14:25043582 [GRCh37] Chr14:14q12	likely benign
NM_001911.3(CTSG):c.251A>C (p.Asn84Thr)	single nucleotide variant	not specified [RCV004343610]	Chr14:24574763 [GRCh38] Chr14:25043969 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.171C>G (p.Asp57Glu)	single nucleotide variant	not specified [RCV004342987]	Chr14:24575297 [GRCh38] Chr14:25044503 [GRCh37] Chr14:14q12	uncertain significance
GRCh37/hg19 14q11.2-23.1(chr14:20511673-61826023)x3	copy number gain	not provided [RCV003485022]	Chr14:20511673..61826023 [GRCh37] Chr14:14q11.2-23.1	pathogenic
GRCh37/hg19 14q11.2-12(chr14:24445622-28262222)x1	copy number loss	not provided [RCV003483196]	Chr14:24445622..28262222 [GRCh37] Chr14:14q11.2-12	likely pathogenic
NM_001911.3(CTSG):c.193T>G (p.Cys65Gly)	single nucleotide variant	not specified [RCV004375062]	Chr14:24575275 [GRCh38] Chr14:25044481 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.224G>A (p.Gly75Asp)	single nucleotide variant	not specified [RCV004375063]	Chr14:24574790 [GRCh38] Chr14:25043996 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.369C>A (p.Asn123Lys)	single nucleotide variant	not specified [RCV004375064]	Chr14:24574470 [GRCh38] Chr14:25043676 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.428C>G (p.Thr143Ser)	single nucleotide variant	not specified [RCV004375065]	Chr14:24574411 [GRCh38] Chr14:25043617 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.346A>G (p.Arg116Gly)	single nucleotide variant	not specified [RCV004616006]	Chr14:24574493 [GRCh38] Chr14:25043699 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.124A>G (p.Ser42Gly)	single nucleotide variant	not specified [RCV004910764]	Chr14:24575344 [GRCh38] Chr14:25044550 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.286C>T (p.Arg96Cys)	single nucleotide variant	not specified [RCV004910766]	Chr14:24574728 [GRCh38] Chr14:25043934 [GRCh37] Chr14:14q12	uncertain significance
NM_001911.3(CTSG):c.463G>A (p.Gly155Arg)	single nucleotide variant	not specified [RCV004910765]	Chr14:24574376 [GRCh38] Chr14:25043582 [GRCh37] Chr14:14q12	likely benign

Predicted Target Of

	Summary Value
Count of predictions:	284
Count of miRNA genes:	258
Interacting mature miRNAs:	266
Transcripts:	ENST00000216336, ENST00000552252
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597388434	GWAS1484508_H	conotruncal heart malformations QTL GWAS1484508 (human)		0.000008	congenital heart disease		14	24575006	24575007	Human

RH71371

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	14	25,042,796 - 25,042,974	UniSTS	GRCh37
Build 36	14	24,112,636 - 24,112,814	RGD	NCBI36
Celera	14	4,907,582 - 4,907,760	RGD
Cytogenetic Map	14	q11.2	UniSTS
HuRef	14	5,157,603 - 5,157,781	UniSTS

GDB:177812

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	14	25,045,378 - 25,045,777	UniSTS	GRCh37
Build 36	14	24,115,218 - 24,115,617	RGD	NCBI36
Celera	14	4,910,164 - 4,910,563	RGD
Cytogenetic Map	14	q11.2	UniSTS
HuRef	14	5,160,185 - 5,160,584	UniSTS

PMC123164P2

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	14	25,044,829 - 25,045,349	UniSTS	GRCh37
Build 36	14	24,114,669 - 24,115,189	RGD	NCBI36
Celera	14	4,909,615 - 4,910,135	RGD
Cytogenetic Map	14	q11.2	UniSTS
HuRef	14	5,159,636 - 5,160,156	UniSTS

PMC24673P1

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	14	25,045,431 - 25,045,777	UniSTS	GRCh37
Build 36	14	24,115,271 - 24,115,617	RGD	NCBI36
Celera	14	4,910,217 - 4,910,563	RGD
Cytogenetic Map	14	q11.2	UniSTS
HuRef	14	5,160,238 - 5,160,584	UniSTS

RH69752

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	14	25,042,787 - 25,042,971	UniSTS	GRCh37
Build 36	14	24,112,627 - 24,112,811	RGD	NCBI36
Celera	14	4,907,573 - 4,907,757	RGD
Cytogenetic Map	14	q11.2	UniSTS
HuRef	14	5,157,594 - 5,157,778	UniSTS
GeneMap99-GB4 RH Map	14	19.84	UniSTS

RH68974

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	14	25,042,839 - 25,043,023	UniSTS	GRCh37
Build 36	14	24,112,679 - 24,112,863	RGD	NCBI36
Celera	14	4,907,625 - 4,907,809	RGD
Cytogenetic Map	14	q11.2	UniSTS
HuRef	14	5,157,646 - 5,157,830	UniSTS
GeneMap99-GB4 RH Map	14	19.84	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2309	2724	2150	3510	1514	2026	4	573	1453	410	2027	6417	5807	20	2575	1	752	1535	1358	165	1


RefSeq Transcripts	NM_001911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_011536499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054375488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI272833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK225914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL136018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC014460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR456807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR541704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J04990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M16117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M59717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000216336 ⟹ ENSP00000216336

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	14	24,573,518 - 24,576,250 (-)	Ensembl

Ensembl Acc Id:

ENST00000552252

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	14	24,573,522 - 24,576,250 (-)	Ensembl

RefSeq Acc Id:

NM_001911 ⟹ NP_001902

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	14	24,573,518 - 24,576,250 (-)	NCBI
GRCh37	14	25,042,724 - 25,045,466 (-)	ENTREZGENE
Build 36	14	24,112,564 - 24,115,306 (-)	NCBI Archive
HuRef	14	5,157,531 - 5,160,273 (-)	ENTREZGENE
CHM1_1	14	25,041,620 - 25,044,362 (-)	NCBI
T2T-CHM13v2.0	14	18,772,405 - 18,775,137 (-)	NCBI

Sequence:

show sequence

AACTGACTGGGCAGCCTTTCAGGAAAGATGCAGCCACTCCTGCTTCTGCTGGCCTTTCTCCTACCCACTGGGGCTGAGGCAGGGGAGATCATCGGAGGCCGGGAGAGCAGGCCCCACTCCCGCCCCTA
CATGGCGTATCTTCAGATCCAGAGTCCAGCAGGTCAGAGCAGATGTGGAGGGTTCCTGGTGCGAGAAGACTTTGTGCTGACAGCAGCTCATTGCTGGGGAAGCAATATAAATGTCACCCTGGGCGCCC
ACAATATCCAGAGACGGGAAAACACCCAGCAACACATCACTGCGCGCAGAGCCATCCGCCACCCTCAATATAATCAGCGGACCATCCAGAATGACATCATGTTATTGCAGCTGAGCAGAAGAGTCAGA
CGGAATCGAAACGTGAACCCAGTGGCTCTGCCTAGAGCCCAGGAGGGACTGAGACCCGGGACGCTGTGCACTGTGGCCGGCTGGGGCAGGGTCAGCATGAGGAGGGGAACAGATACACTCCGAGAGGT
GCAGCTGAGAGTGCAGAGGGATAGGCAGTGCCTCCGCATCTTCGGTTCCTACGACCCCCGAAGGCAGATTTGTGTGGGGGACCGGCGGGAACGGAAGGCTGCCTTCAAGGGGGATTCCGGAGGCCCCC
TGCTGTGTAACAATGTGGCCCACGGCATCGTCTCCTATGGAAAGTCGTCAGGGGTTCCTCCAGAAGTCTTCACCAGGGTCTCAAGTTTCCTGCCCTGGATAAGGACAACAATGAGAAGCTTCAAACTG
CTGGATCAGATGGAGACCCCCCTGTGACTGACTCTTCTTCTCGGGGACACAGGCCAGCTCCACAGTGTTGCCAGAGCCTTAATAAACGTCCACAGAGTATAAATAACCAATTCCTCATTTGTTCATTA
AACGTCATTCAGTACTTA

hide sequence

RefSeq Acc Id:

XM_011536499 ⟹ XP_011534801

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	14	24,573,518 - 24,576,250 (-)	NCBI

Sequence:

show sequence

AGCCTTTCAGGAAAGATGCAGCCACTCCTGCTTCTGCTGGCCTTTCTCCTACCCACTGGGGCTG
AGGCAGGTTCAGCAAGCATAGAGCTAAGTGCCAAATGCTTCCTTCCAGGGGAGATCATCGGAGGCCGGGAGAGCAGGCCCCACTCCCGCCCCTACATGGCGTATCTTCAGATCCAGAGTCCAGCAGGT
CAGAGCAGATGTGGAGGGTTCCTGGTGCGAGAAGACTTTGTGCTGACAGCAGCTCATTGCTGGGGAAGCAATATAAATGTCACCCTGGGCGCCCACAATATCCAGAGACGGGAAAACACCCAGCAACA
CATCACTGCGCGCAGAGCCATCCGCCACCCTCAATATAATCAGCGGACCATCCAGAATGACATCATGTTATTGCAGCTGAGCAGAAGAGTCAGACGGAATCGAAACGTGAACCCAGTGGCTCTGCCTA
GAGCCCAGGAGGGACTGAGACCCGGGACGCTGTGCACTGTGGCCGGCTGGGGCAGGGTCAGCATGAGGAGGGGAACAGATACACTCCGAGAGGTGCAGCTGAGAGTGCAGAGGGATAGGCAGTGCCTC
CGCATCTTCGGTTCCTACGACCCCCGAAGGCAGATTTGTGTGGGGGACCGGCGGGAACGGAAGGCTGCCTTCAAGGGGGATTCCGGAGGCCCCCTGCTGTGTAACAATGTGGCCCACGGCATCGTCTC
CTATGGAAAGTCGTCAGGGGTTCCTCCAGAAGTCTTCACCAGGGTCTCAAGTTTCCTGCCCTGGATAAGGACAACAATGAGAAGCTTCAAACTGCTGGATCAGATGGAGACCCCCCTGTGACTGACTC
TTCTTCTCGGGGACACAGGCCAGCTCCACAGTGTTGCCAGAGCCTTAATAAACGTCCACAGAGTATAAATAACCAA

hide sequence

RefSeq Acc Id:

XM_054375488 ⟹ XP_054231463

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	14	18,772,405 - 18,775,137 (-)	NCBI


Protein RefSeqs	NP_001902	(Get FASTA)	NCBI Sequence Viewer
	XP_011534801	(Get FASTA)	NCBI Sequence Viewer
	XP_054231463	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA51919	(Get FASTA)	NCBI Sequence Viewer
	AAA52126	(Get FASTA)	NCBI Sequence Viewer
	AAH14460	(Get FASTA)	NCBI Sequence Viewer
	CAG33088	(Get FASTA)	NCBI Sequence Viewer
	CAG46505	(Get FASTA)	NCBI Sequence Viewer
	EAW66006	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000216336
	ENSP00000216336.2
GenBank Protein	P08311	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001902 ⟸ NM_001911
- Peptide Label:	preproprotein
- UniProtKB:	Q9UCA5 (UniProtKB/Swiss-Prot), Q6IBJ6 (UniProtKB/Swiss-Prot), Q9UCU6 (UniProtKB/Swiss-Prot), P08311 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVA LPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL hide sequence

RefSeq Acc Id:

XP_011534801 ⟸ XM_011536499

- Peptide Label:

isoform X1

- Sequence:

show sequence

MQPLLLLLAFLLPTGAEAGSASIELSAKCFLPGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQL
SRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTM
RSFKLLDQMETPL

hide sequence

Ensembl Acc Id:

ENSP00000216336 ⟸ ENST00000216336

RefSeq Acc Id:	XP_054231463 ⟸ XM_054375488
- Peptide Label:	isoform X1

Protein Domains

Peptidase S1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P08311-F1-model_v2	AlphaFold	P08311	1-255	view protein structure

RGD ID:

6791392

Promoter ID:

HG_KWN:19120

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

NB4

Transcripts:

NM_001911

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	14	24,115,036 - 24,115,536 (-)	MPROMDB

RGD ID:

7227329

Promoter ID:

EPDNEW_H19411

Type:

initiation region

Name:

CTSG_1

Description:

cathepsin G

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	14	24,576,250 - 24,576,310	EPDNEW

Database	Acc Id	Source(s)
COSMIC	CTSG	COSMIC
Ensembl Genes	ENSG00000100448	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000216336	ENTREZGENE
	ENST00000216336.3	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.10.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000100448	GTEx
HGNC ID	HGNC:2532	ENTREZGENE
Human Proteome Map	CTSG	Human Proteome Map
InterPro	Peptidase_S1_PA	UniProtKB/Swiss-Prot
	Peptidase_S1_PA_chymotrypsin	UniProtKB/Swiss-Prot
	Peptidase_S1A	UniProtKB/Swiss-Prot
	Trypsin_dom	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
	TRYPSIN_SER	UniProtKB/Swiss-Prot
KEGG Report	hsa:1511	UniProtKB/Swiss-Prot
NCBI Gene	1511	ENTREZGENE
OMIM	116830	OMIM
PANTHER	CATHEPSIN G	UniProtKB/Swiss-Prot
	KALLIKREIN-RELATED	UniProtKB/Swiss-Prot
Pfam	Trypsin	UniProtKB/Swiss-Prot
PharmGKB	CTSG	RGD, PharmGKB
PRINTS	CHYMOTRYPSIN	UniProtKB/Swiss-Prot
PROSITE	TRYPSIN_DOM	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
	TRYPSIN_SER	UniProtKB/Swiss-Prot
SMART	Tryp_SPc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50494	UniProtKB/Swiss-Prot
UniProt	CATG_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6IBJ6	ENTREZGENE
	Q9UCA5	ENTREZGENE
	Q9UCU6	ENTREZGENE
UniProt Secondary	Q6IBJ6	UniProtKB/Swiss-Prot
	Q9UCA5	UniProtKB/Swiss-Prot
	Q9UCU6	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)