Symbol:
Lgalsl
Name:
galectin like
RGD ID:
1316597
MGI Page
MGI
Description:
Predicted to enable carbohydrate binding activity. Located in collagen-containing extracellular matrix. Is expressed in several structures, including cerebral cortex; dorsal root ganglion; retina nuclear layer; submandibular gland primordium; and thoracic segment skeleton. Orthologous to human LGALSL (galectin like).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110067D22Rik; A530071M23; galectin-related protein; galectin-related protein A; Grpa; Hspc159; lectin galactoside-binding-like protein A; lectin, galactoside binding-like; Lgalsla; RP23-455B19.1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LGALSL (galectin like) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Lgalsl (galectin-like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lgalsl (galectin like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LGALSL (galectin like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LGALSL (galectin like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lgalsl (galectin like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LGALSL (galectin like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LGALSL (galectin like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lgalsl (galectin like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Lgalsl (galectin-like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
LGALSL (galectin like)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
lgalsla (lectin, galactoside-binding-like a)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
lgalslb (lectin, galactoside-binding-like b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Drosophila melanogaster (fruit fly):
CG13950
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F46A8.3
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F46A8.4
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F49F1.10
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F49F1.11
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F46A8.8
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F46A8.5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F49F1.18
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F49F1.9
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
F40H6.5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
C27C7.5
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
pqn-84
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
lgalsl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Lgals1-ps1
Lgalsl2
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 20,773,355 - 20,781,916 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 20,773,576 - 20,781,056 (-) Ensembl GRCm39 Ensembl GRCm38 11 20,823,355 - 20,831,916 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 20,823,576 - 20,831,056 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 20,723,358 - 20,731,111 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 20,723,581 - 20,731,082 (-) NCBI MGSCv36 mm8 Celera 11 22,970,372 - 22,978,258 (-) NCBI Celera Cytogenetic Map 11 A3.1 NCBI cM Map 11 13.53 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lgalsl Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of LGALSL mRNA CTD PMID:36331819 Lgalsl Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LGALSL mRNA CTD PMID:22206623 Lgalsl Mouse 1-naphthyl isothiocyanate decreases expression ISO RGD:1307414 6480464 1-Naphthylisothiocyanate results in decreased expression of LGALSL mRNA CTD PMID:25380136 Lgalsl Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of LGALSL mRNA CTD PMID:39298647 Lgalsl Mouse 17beta-estradiol decreases expression ISO RGD:1307414 6480464 Estradiol results in decreased expression of LGALSL mRNA CTD PMID:35192832 Lgalsl Mouse 17beta-estradiol increases expression ISO RGD:1606012 6480464 Estradiol results in increased expression of LGALSL mRNA CTD PMID:31614463 Lgalsl Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1606012 6480464 Tetrachlorodibenzodioxin results in decreased expression of LGALSL mRNA CTD PMID:21632981 Lgalsl Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1307414 6480464 Tetrachlorodibenzodioxin results in decreased expression of LGALSL mRNA CTD PMID:33387578 Lgalsl Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LGALSL mRNA CTD PMID:28922406 Lgalsl Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1307414 6480464 Tetrachlorodibenzodioxin results in increased expression of LGALSL mRNA CTD PMID:21215274|PMID:34747641 Lgalsl Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1307414 6480464 Tetrachlorodibenzodioxin affects the expression of LGALSL mRNA CTD PMID:22298810 Lgalsl Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1307414 6480464 AHR protein alternative form inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of LGALSL mRNA] CTD PMID:21215274 Lgalsl Mouse 2,6-dimethoxyphenol multiple interactions ISO RGD:1606012 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization more ... CTD PMID:38598786 Lgalsl Mouse 2-hydroxypropanoic acid decreases expression ISO RGD:1606012 6480464 Lactic Acid results in decreased expression of LGALSL mRNA CTD PMID:30851411 Lgalsl Mouse 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1307414 6480464 4,4'-diaminodiphenylmethane results in decreased expression of LGALSL mRNA CTD PMID:25380136 Lgalsl Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of LGALSL mRNA CTD PMID:39298647 Lgalsl Mouse acrolein multiple interactions ISO RGD:1606012 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Lgalsl Mouse Actein decreases expression ISO RGD:1307414 6480464 actein results in decreased expression of LGALSL protein CTD PMID:29969672 Lgalsl Mouse all-trans-retinoic acid decreases expression ISO RGD:1606012 6480464 Tretinoin results in decreased expression of LGALSL mRNA CTD PMID:33167477 Lgalsl Mouse alpha-pinene multiple interactions ISO RGD:1606012 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Lgalsl Mouse antirheumatic drug increases expression ISO RGD:1606012 6480464 Antirheumatic Agents results in increased expression of LGALSL mRNA CTD PMID:24449571 Lgalsl Mouse arsane multiple interactions ISO RGD:1606012 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LGALSL more ... CTD PMID:32525701 Lgalsl Mouse arsenic atom multiple interactions ISO RGD:1606012 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LGALSL more ... CTD PMID:32525701 Lgalsl Mouse arsenous acid multiple interactions ISO RGD:1606012 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to LGALSL protein] CTD PMID:26598702 Lgalsl Mouse azoxystrobin multiple interactions ISO RGD:1307414 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Lgalsl Mouse benzo[a]pyrene increases expression ISO RGD:1307414 6480464 Benzo(a)pyrene results in increased expression of LGALSL mRNA CTD PMID:21839799 Lgalsl Mouse benzo[a]pyrene diol epoxide I increases expression ISO RGD:1606012 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of LGALSL mRNA CTD PMID:19150397 Lgalsl Mouse Benzo[k]fluoranthene decreases expression EXP 6480464 benzo(k)fluoranthene results in decreased expression of LGALSL mRNA CTD PMID:26377693 Lgalsl Mouse bis(2-chloroethyl) sulfide increases expression ISO RGD:1606012 6480464 Mustard Gas results in increased expression of LGALSL mRNA CTD PMID:25102026 Lgalsl Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of LGALSL mRNA CTD PMID:33754040 Lgalsl Mouse bisphenol A increases expression ISO RGD:1307414 6480464 bisphenol A results in increased expression of LGALSL mRNA CTD PMID:25181051|PMID:30816183|PMID:35192832 Lgalsl Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of LGALSL mRNA CTD PMID:38685157 Lgalsl Mouse bromuconazole affects expression ISO RGD:1307414 6480464 bromuconazole affects the expression of LGALSL mRNA CTD PMID:33789219 Lgalsl Mouse buspirone decreases expression ISO RGD:1307414 6480464 Buspirone results in decreased expression of LGALSL mRNA CTD PMID:24136188 Lgalsl Mouse caffeine decreases phosphorylation ISO RGD:1606012 6480464 Caffeine results in decreased phosphorylation of LGALSL protein CTD PMID:35688186 Lgalsl Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of LGALSL mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Lgalsl Mouse CGP 52608 multiple interactions ISO RGD:1606012 6480464 CGP 52608 promotes the reaction [RORA protein binds to LGALSL gene] CTD PMID:28238834 Lgalsl Mouse chlorpyrifos multiple interactions ISO RGD:1307414 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Lgalsl Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of LGALSL mRNA CTD PMID:37019170 Lgalsl Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of LGALSL mRNA CTD PMID:27462272 Lgalsl Mouse cobalt dichloride decreases expression ISO RGD:1307414 6480464 cobaltous chloride results in decreased expression of LGALSL mRNA CTD PMID:24386269 Lgalsl Mouse copper atom increases expression ISO RGD:1307414 6480464 Copper results in increased expression of LGALSL mRNA CTD PMID:30556269 Lgalsl Mouse copper(0) increases expression ISO RGD:1307414 6480464 Copper results in increased expression of LGALSL mRNA CTD PMID:30556269 Lgalsl Mouse corosolic acid increases expression ISO RGD:1606012 6480464 corosolic acid results in increased expression of LGALSL mRNA CTD PMID:37939859 Lgalsl Mouse coumarin increases phosphorylation ISO RGD:1606012 6480464 coumarin results in increased phosphorylation of LGALSL protein CTD PMID:35688186 Lgalsl Mouse cyclosporin A increases methylation ISO RGD:1606012 6480464 Cyclosporine results in increased methylation of LGALSL promoter CTD PMID:27989131 Lgalsl Mouse decabromodiphenyl ether decreases expression ISO RGD:1307414 6480464 decabromobiphenyl ether results in decreased expression of LGALSL mRNA CTD PMID:23640034 Lgalsl Mouse diarsenic trioxide multiple interactions ISO RGD:1606012 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to LGALSL protein] CTD PMID:26598702 Lgalsl Mouse dibenz[a,h]anthracene decreases expression EXP 6480464 1,2,5,6-dibenzanthracene results in decreased expression of LGALSL mRNA CTD PMID:26377693 Lgalsl Mouse diquat increases expression EXP 6480464 Diquat results in increased expression of LGALSL protein CTD PMID:36851058 Lgalsl Mouse doxorubicin decreases expression ISO RGD:1606012 6480464 Doxorubicin results in decreased expression of LGALSL mRNA CTD PMID:29803840 Lgalsl Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of LGALSL mRNA CTD PMID:35436446 Lgalsl Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of LGALSL mRNA CTD PMID:30319688 Lgalsl Mouse flutamide decreases expression ISO RGD:1307414 6480464 Flutamide results in decreased expression of LGALSL mRNA CTD PMID:24136188 Lgalsl Mouse folic acid multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LGALSL mRNA CTD PMID:22206623 Lgalsl Mouse furfural multiple interactions ISO RGD:1606012 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization more ... CTD PMID:38598786 Lgalsl Mouse gentamycin decreases expression ISO RGD:1307414 6480464 Gentamicins results in decreased expression of LGALSL mRNA CTD PMID:33387578 Lgalsl Mouse glyphosate multiple interactions ISO RGD:1307414 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Lgalsl Mouse hydroquinone increases expression ISO RGD:1606012 6480464 hydroquinone results in increased expression of LGALSL mRNA CTD PMID:31256213 Lgalsl Mouse imidacloprid multiple interactions ISO RGD:1307414 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Lgalsl Mouse indole-3-methanol multiple interactions ISO RGD:1307414 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of LGALSL mRNA CTD PMID:22129741 Lgalsl Mouse ivermectin decreases expression ISO RGD:1606012 6480464 Ivermectin results in decreased expression of LGALSL protein CTD PMID:32959892 Lgalsl Mouse methapyrilene decreases expression ISO RGD:1307414 6480464 Methapyrilene results in decreased expression of LGALSL mRNA CTD PMID:30467583 Lgalsl Mouse N-acetyl-L-cysteine multiple interactions ISO RGD:1307414 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of LGALSL mRNA CTD PMID:22129741 Lgalsl Mouse N-nitrosodiethylamine multiple interactions ISO RGD:1307414 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of LGALSL mRNA CTD PMID:22129741 Lgalsl Mouse N-nitrosodimethylamine decreases expression ISO RGD:1307414 6480464 Dimethylnitrosamine results in decreased expression of LGALSL mRNA CTD PMID:25380136 Lgalsl Mouse nefazodone decreases expression ISO RGD:1307414 6480464 nefazodone results in decreased expression of LGALSL mRNA CTD PMID:24136188 Lgalsl Mouse nimesulide decreases expression ISO RGD:1307414 6480464 nimesulide results in decreased expression of LGALSL mRNA CTD PMID:24136188 Lgalsl Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of LGALSL more ... CTD PMID:35964746 Lgalsl Mouse oxaliplatin multiple interactions ISO RGD:1307414 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LGALSL mRNA CTD PMID:25729387 Lgalsl Mouse ozone multiple interactions ISO RGD:1606012 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Lgalsl Mouse p-toluidine decreases expression ISO RGD:1307414 6480464 4-toluidine results in decreased expression of LGALSL mRNA CTD PMID:27638505 Lgalsl Mouse paracetamol increases expression ISO RGD:1606012 6480464 Acetaminophen results in increased expression of LGALSL mRNA CTD PMID:22230336 Lgalsl Mouse paracetamol decreases expression ISO RGD:1307414 6480464 Acetaminophen results in decreased expression of LGALSL mRNA CTD PMID:33387578 Lgalsl Mouse paracetamol decreases expression ISO RGD:1606012 6480464 Acetaminophen results in decreased expression of LGALSL mRNA CTD PMID:21420995 Lgalsl Mouse perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of LGALSL protein CTD PMID:26178269 Lgalsl Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of LGALSL mRNA CTD PMID:36331819 Lgalsl Mouse phenobarbital affects expression ISO RGD:1606012 6480464 Phenobarbital affects the expression of LGALSL mRNA CTD PMID:19159669 Lgalsl Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of LGALSL mRNA CTD PMID:23091169 Lgalsl Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of LGALSL mRNA CTD PMID:23811191 Lgalsl Mouse pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of LGALSL mRNA CTD PMID:28903501 Lgalsl Mouse progesterone decreases expression ISO RGD:1606012 6480464 Progesterone results in decreased expression of LGALSL mRNA CTD PMID:20864642 Lgalsl Mouse rac-lactic acid decreases expression ISO RGD:1606012 6480464 Lactic Acid results in decreased expression of LGALSL mRNA CTD PMID:30851411 Lgalsl Mouse rotenone decreases expression ISO RGD:1307414 6480464 Rotenone results in decreased expression of LGALSL mRNA CTD PMID:28374803 Lgalsl Mouse rotenone decreases expression ISO RGD:1606012 6480464 Rotenone results in decreased expression of LGALSL mRNA CTD PMID:29955902 Lgalsl Mouse sodium arsenate multiple interactions ISO RGD:1606012 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of LGALSL more ... CTD PMID:32525701 Lgalsl Mouse sodium arsenite increases expression ISO RGD:1606012 6480464 sodium arsenite results in increased expression of LGALSL mRNA CTD PMID:22714537 Lgalsl Mouse sodium arsenite affects expression ISO RGD:1606012 6480464 sodium arsenite affects the expression of LGALSL mRNA CTD PMID:29319823 Lgalsl Mouse sodium chloride multiple interactions ISO RGD:1606012 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of LGALSL protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Lgalsl Mouse sunitinib increases expression ISO RGD:1606012 6480464 Sunitinib results in increased expression of LGALSL mRNA CTD PMID:31533062 Lgalsl Mouse temozolomide increases expression ISO RGD:1606012 6480464 Temozolomide results in increased expression of LGALSL mRNA CTD PMID:31758290 Lgalsl Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of LGALSL mRNA CTD PMID:27339419 Lgalsl Mouse thiabendazole multiple interactions ISO RGD:1307414 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with more ... CTD PMID:33854195 Lgalsl Mouse thimerosal decreases expression ISO RGD:1606012 6480464 Thimerosal results in decreased expression of LGALSL mRNA CTD PMID:27188386 Lgalsl Mouse thioacetamide increases expression ISO RGD:1307414 6480464 Thioacetamide results in increased expression of LGALSL mRNA CTD PMID:34492290 Lgalsl Mouse thiram decreases expression ISO RGD:1606012 6480464 Thiram results in decreased expression of LGALSL mRNA CTD PMID:38568856 Lgalsl Mouse topotecan multiple interactions ISO RGD:1307414 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of LGALSL mRNA CTD PMID:25729387 Lgalsl Mouse trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of LGALSL mRNA CTD PMID:25549359 Lgalsl Mouse triphenyl phosphate decreases expression ISO RGD:1307414 6480464 triphenyl phosphate results in decreased expression of LGALSL mRNA CTD PMID:30589522 Lgalsl Mouse trovafloxacin decreases expression ISO RGD:1307414 6480464 trovafloxacin results in decreased expression of LGALSL mRNA CTD PMID:24136188 Lgalsl Mouse urethane decreases expression ISO RGD:1606012 6480464 Urethane results in decreased expression of LGALSL mRNA CTD PMID:28818685 Lgalsl Mouse valproic acid decreases expression ISO RGD:1606012 6480464 Valproic Acid results in decreased expression of LGALSL mRNA CTD PMID:23179753 Lgalsl Mouse valproic acid affects expression ISO RGD:1606012 6480464 Valproic Acid affects the expression of LGALSL mRNA CTD PMID:25979313 Lgalsl Mouse vinclozolin affects expression ISO RGD:1307414 6480464 vinclozolin affects the expression of LGALSL mRNA CTD PMID:19015723
(1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP) acrolein (ISO) Actein (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[k]fluoranthene (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol F (EXP) bromuconazole (ISO) buspirone (ISO) caffeine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlorpyrifos (EXP,ISO) clobetasol (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) corosolic acid (ISO) coumarin (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (EXP) diquat (EXP) doxorubicin (ISO) epoxiconazole (EXP) ethanol (EXP) flutamide (ISO) folic acid (EXP) furfural (ISO) gentamycin (ISO) glyphosate (ISO) hydroquinone (ISO) imidacloprid (ISO) indole-3-methanol (ISO) ivermectin (ISO) methapyrilene (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) nefazodone (ISO) nimesulide (ISO) nitrates (EXP) oxaliplatin (ISO) ozone (ISO) p-toluidine (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP,ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) rac-lactic acid (ISO) rotenone (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (EXP) thiabendazole (ISO) thimerosal (ISO) thioacetamide (ISO) thiram (ISO) topotecan (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (ISO)
Lgalsl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 20,773,355 - 20,781,916 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 20,773,576 - 20,781,056 (-) Ensembl GRCm39 Ensembl GRCm38 11 20,823,355 - 20,831,916 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 20,823,576 - 20,831,056 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 20,723,358 - 20,731,111 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 20,723,581 - 20,731,082 (-) NCBI MGSCv36 mm8 Celera 11 22,970,372 - 22,978,258 (-) NCBI Celera Cytogenetic Map 11 A3.1 NCBI cM Map 11 13.53 NCBI
LGALSL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 64,454,162 - 64,461,381 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 64,453,969 - 64,461,381 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 64,681,296 - 64,688,515 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 64,534,831 - 64,542,021 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 64,527,497 - 64,534,686 (+) NCBI Celera Cytogenetic Map 2 p14 NCBI HuRef 2 64,415,208 - 64,422,398 (+) NCBI HuRef CHM1_1 2 64,611,958 - 64,619,147 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 64,462,631 - 64,470,536 (+) NCBI T2T-CHM13v2.0
Lgalsl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 99,198,340 - 99,205,846 (-) NCBI GRCr8 mRatBN7.2 14 94,996,991 - 95,004,499 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 94,996,990 - 95,004,980 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 99,343,543 - 99,351,050 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 100,583,831 - 100,591,338 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 97,057,818 - 97,065,375 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 105,047,915 - 105,055,421 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 105,047,919 - 105,055,421 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 104,777,090 - 104,784,596 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 101,620,859 - 101,628,365 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 101,642,052 - 101,661,484 (-) NCBI Celera 14 94,011,598 - 94,019,106 (-) NCBI Celera Cytogenetic Map 14 q22 NCBI
Lgalsl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 19,953,984 - 19,962,699 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 19,955,858 - 19,962,170 (-) NCBI ChiLan1.0 ChiLan1.0
LGALSL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 61,937,138 - 61,944,784 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 61,943,865 - 61,948,105 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 64,522,883 - 64,529,902 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 65,646,047 - 65,653,147 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 65,642,060 - 65,653,141 (+) Ensembl panpan1.1 panPan2
LGALSL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 64,044,583 - 64,052,335 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 64,045,855 - 64,049,383 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 63,932,971 - 63,940,278 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 65,053,516 - 65,060,819 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 65,053,113 - 65,122,539 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 64,734,752 - 64,742,044 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 65,044,098 - 65,051,397 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 65,336,299 - 65,340,838 (+) NCBI UU_Cfam_GSD_1.0
Lgalsl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 19,273,602 - 19,278,589 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 9,292,703 - 9,299,871 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 9,292,703 - 9,299,892 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LGALSL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 77,472,166 - 77,479,361 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 77,472,153 - 77,479,415 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 81,321,483 - 81,326,298 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LGALSL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 42,551,760 - 42,559,271 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 42,551,775 - 42,559,238 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 69,315,920 - 69,323,716 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lgalsl
.
Predicted Target Of
Count of predictions: 1032 Count of miRNA genes: 625 Interacting mature miRNAs: 752 Transcripts: ENSMUST00000047028, ENSMUST00000132928, ENSMUST00000144441, ENSMUST00000154300 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1302171 Pgia28_m proteoglycan induced arthritis 28 (mouse) Not determined 11 8906097 42906218 Mouse 1357720 Kidpq1_m kidney weight percentage QTL 1 (mouse) Not determined 11 12268637 68500330 Mouse 1357722 Vtbt11_m vertebral trabecular bone trait 11 (mouse) Not determined 11 1 23880487 Mouse 1357851 Scfq3_m subcutaneous fat pad weight QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 27226762 Feml21_m femur length 21, 16 week (mouse) 11 11750000 65990826 Mouse 1301765 Skull15_m skull morphology 15 (mouse) Not determined 11 1 25976374 Mouse 4141470 Egq4_m early growth QTL 4 (mouse) Not determined 12268637 68500330 Mouse 13524844 Ppiq9_m prepulse inhibition QTL 9 (mouse) 11 9049997 35077325 Mouse 4142109 W10q2_m weight 10 weeks QTL 2 (mouse) Not determined 12268637 68500330 Mouse 1300661 Lmr6_m leishmaniasis resistance 6 (mouse) Not determined 11 1 25976374 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 10412216 Eae44_m experimental allergic encephalomyelitis susceptibility 44 (mouse) Not determined 11 12268637 39950840 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 26884401 Huml4_m humerus length 4, 10 week (mouse) 11 11550000 68490826 Mouse 10053687 Eae6_m susceptibility to experimental allergic encephalomyelitis 6 (mouse) Not determined 11 17781966 68500330 Mouse 27226798 Scvln18_m sacral vertebrae length 2, 16 week (mouse) 11 3250000 60690826 Mouse 4141582 Lgaq1_m late growth adjusted QTL 1 (mouse) Not determined 12268637 68500330 Mouse 4141966 Tailq1_m tail length QTL 1 (mouse) Not determined 12268637 68500330 Mouse 1300768 Tshp9_m tooth shape 9 (mouse) Not determined 11 1 25976374 Mouse 10053676 Eae44a_m experimental allergic encephalomyelitis susceptibility 44a (mouse) Not determined 11 4507896 21379532 Mouse 1558945 Orgwq8_m organ weight QTL 8 (mouse) Not determined 11 17056175 67078411 Mouse 4142216 Lgq1_m late growth QTL 1 (mouse) Not determined 12268637 68500330 Mouse 1300905 Scc6_m colon tumor susceptibility 6 (mouse) Not determined 11 6880277 89019734 Mouse 14746971 Manh70_m mandible shape 70 (mouse) 11 19905890 53905890 Mouse 39128214 Lwq20_m liver weight QTL 20 (mouse) 11 12268637 118022724 Mouse 26884446 Sklq10_m skull length QTL 10, 10 week (mouse) 11 3250000 62890826 Mouse 4141047 Nilac1_m nicotine induced locomotor activity 1 (mouse) Not determined 11 9011780 43011942 Mouse 1559002 Lmrq4_m Leishmania major resistance QTL 4 (mouse) Not determined 11 12268637 69684947 Mouse 1300938 Bulb3_m bulb size 3 (mouse) Not determined 11 18578616 52578716 Mouse 1357518 Tgyl1_m triglyceride level 1 (mouse) Not determined 11 6880277 33916219 Mouse 4142308 W6q3_m weight 6 weeks QTL 3 (mouse) Not determined 11 12268637 68500330 Mouse 1357640 Orq2_m ovulation rate QTL 2 (mouse) Not determined 11 12268637 68500330 Mouse 1300599 Cocrb11_m cocaine related behavior 11 (mouse) Not determined 11 2670355 36671472 Mouse 1357437 Epfq4_m epididymal fat pad weight QTL 4 (mouse) Not determined 11 12268637 68500330 Mouse 27226741 Metcl5_m metatarsal-calcaneal length 5, 5 week (mouse) 11 4650000 46290827 Mouse 1300990 Bits3_m bitterness sensitivity 3 (mouse) Not determined 11 8372121 42372260 Mouse 27226738 Metcl11_m metatarsal-calcaneal length 11, 10 week (mouse) 11 8850000 61390826 Mouse 27226735 Metcl16_m metatarsal-calcaneal length 16, 16 week (mouse) 11 5250000 35090827 Mouse 12801459 Leuf1_m leukocyte filtration 1 (mouse) 11 18578616 52578716 Mouse 1300579 Thypr1_m thymocyte proliferative response 1 (mouse) Not determined 11 19282577 53282715 Mouse 10044008 Hbnr15_m Heligmosomoides bakeri nematode resistance 15 (mouse) Not determined 11 227052 34227232 Mouse 12801457 Intmrm2_m intima/media ratio modifier 2 (mouse) 11 18578616 52578716 Mouse 12801460 Intim2_m intima modifier 2 (mouse) 11 18578616 52578716 Mouse 27095909 Scvln6_m sacral vertebrae length 2, 5 week (mouse) 11 3250000 44090827 Mouse 4141127 W3q4_m weight 3 weeks QTL 4 (mouse) Not determined 12268637 68500330 Mouse 4141894 Nidd6k_m Nidd6 on KK-A (mouse) Not determined 19124204 96897826 Mouse 13463479 Mchq19_m mean corpuscular hemoglobin QTL 19 (mouse) 11 10951232 44951464 Mouse 27095904 Scvln12_m sacral vertebrae length 2, 10 week (mouse) 11 3250000 34495048 Mouse 13463472 Mcvq15_m mean corpuscular volume QTL 15 (mouse) 11 10951232 44951464 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse
UniSTS:236527
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 20,824,642 - 20,824,923 UniSTS GRCm38 MGSCv37 11 20,724,645 - 20,724,926 UniSTS GRCm37 Celera 11 22,971,660 - 22,971,941 UniSTS Cytogenetic Map 11 A3.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000047028 ⟹ ENSMUSP00000044342
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 20,773,576 - 20,781,056 (-) Ensembl GRCm38.p6 Ensembl 11 20,823,576 - 20,831,056 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000132928
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 20,779,797 - 20,781,022 (-) Ensembl GRCm38.p6 Ensembl 11 20,829,797 - 20,831,022 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000144441
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 20,776,350 - 20,780,755 (-) Ensembl GRCm38.p6 Ensembl 11 20,826,350 - 20,830,755 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000154300
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 20,779,312 - 20,781,056 (-) Ensembl GRCm38.p6 Ensembl 11 20,829,312 - 20,831,056 (-) Ensembl
RefSeq Acc Id:
NM_173752 ⟹ NP_776113
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 20,773,355 - 20,781,108 (-) NCBI GRCm38 11 20,823,355 - 20,831,108 (-) NCBI MGSCv37 11 20,723,358 - 20,731,111 (-) RGD Celera 11 22,970,372 - 22,978,258 (-) RGD cM Map 11 ENTREZGENE
Sequence:
CGGCCGCGCCAGCCTGGGGCGTGCACGCGCGCCCGTGTGTGCGCGCGCCCGGCTCGGACCCGCGCCCGCCGCCGCGTCCCCGGCGCTCGCTGCAGGAACATGGCGGGGTCGGTGGCCGACAGCGACGC
hide sequence
RefSeq Acc Id:
XM_006514629 ⟹ XP_006514692
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 20,773,574 - 20,781,916 (-) NCBI GRCm38 11 20,823,574 - 20,831,916 (-) NCBI
Sequence:
CAGGATACCATTACAGGAGTCTGAGCCTTAGCGTGAAAGAGGAGTGTATTCCCTAGGAAGTATT
hide sequence
RefSeq Acc Id:
XM_030245782 ⟹ XP_030101642
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 20,773,574 - 20,781,645 (-) NCBI GRCm38 11 20,823,574 - 20,831,648 (-) NCBI
Sequence:
TTCTTTATTTAGGGTCAAATATGTACAAGCCTTGGACCTCCATTCTCCTTCTCCTCCAAACAGTGCAACTATCTTTCCTCCCACTAGGTTGGAATTCTCTGAAAGAAGCCATACCAGGTCTTCCTCTT
hide sequence
RefSeq Acc Id:
NP_776113 ⟸ NM_173752
- UniProtKB:
Q8VED9 (UniProtKB/Swiss-Prot), Q8C4P8 (UniProtKB/Swiss-Prot)
- Sequence:
MAGSVADSDAVVKLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEI
hide sequence
RefSeq Acc Id:
XP_006514692 ⟸ XM_006514629
- Peptide Label:
isoform X2
- Sequence:
MRKEKLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLT
hide sequence
RefSeq Acc Id:
XP_030101642 ⟸ XM_030245782
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSMUSP00000044342 ⟸ ENSMUST00000047028
RGD ID: 6820144 Promoter ID: MM_KWN:6584 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Lung Transcripts: NM_173752, OTTMUST00000011674, OTTMUST00000011675, OTTMUST00000011676 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 20,731,009 - 20,731,509 (-) MPROMDB
RGD ID: 8674180 Promoter ID: EPDNEW_M15062 Type: initiation region Name: Lgalsl_1 Description: Mus musculus lectin, galactoside binding-like , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 20,831,024 - 20,831,084 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Lgalsl
galectin like
1110067D22Rik
RIKEN cDNA 1110067D22 gene
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
1110067D22Rik
RIKEN cDNA 1110067D22 gene
Lgalsl
galectin like
Symbol and/or name change
5135510 APPROVED
2022-06-21
Lgalsl
galectin like
Lgalsl
lectin, galactoside binding-like
Symbol and/or name change
5135510 APPROVED
2012-11-20
Lgalsl
lectin, galactoside binding-like
1110067D22Rik
RIKEN cDNA 1110067D22 gene
Symbol and/or name change
5135510 APPROVED
