Symbol:
Sh3glb2
Name:
SH3-domain GRB2-like endophilin B2
RGD ID:
1314187
MGI Page
MGI
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in membrane organization and postsynaptic neurotransmitter receptor internalization. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in glutamatergic synapse; membrane; and postsynaptic endocytic zone. Is expressed in several structures, including central nervous system; dorsal root ganglion; eye; limb; and skeleton. Orthologous to human SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
endophilin-B2; mKIAA1848; SH3 domain-containing GRB2-like protein B2; SH3-containing protein SH3GLB2; SPAS-1; stimulator of prostatic adenocarcinoma-specific T-cells-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Sh3glb2 (SH3 domain-containing GRB2-like endophilin B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sh3glb2 (SH3 domain containing GRB2 like, endophilin B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sh3glb2 (SH3 domain containing GRB2 like, endophilin B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sh3glb2 (SH3 domain containing GRB2 like, endophilin B2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DBNL (drebrin like) HGNC
Panther
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Sh3glb2 (SH3 domain-containing GRB2-like endophilin B2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sh3glb2b (SH3-domain GRB2-like endophilin B2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
sh3glb2a (SH3-domain GRB2-like endophilin B2a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
F35A5.8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
EndoB
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sh3glb2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 30,234,789 - 30,249,380 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 30,234,821 - 30,249,349 (-) Ensembl GRCm39 Ensembl GRCm38 2 30,344,777 - 30,359,358 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 30,344,809 - 30,359,337 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 30,200,329 - 30,214,751 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 30,166,818 - 30,181,240 (-) NCBI MGSCv36 mm8 Celera 2 30,049,844 - 30,064,263 (-) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 21.6 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sh3glb2 Mouse (+)-schisandrin B multiple interactions ISO Sh3glb2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SH3GLB2 mRNA] CTD PMID:31150632 Sh3glb2 Mouse 1,3-dinitrobenzene increases expression ISO Sh3glb2 (Rattus norvegicus) 6480464 3-dinitrobenzene results in increased expression of SH3GLB2 mRNA CTD PMID:21983209 Sh3glb2 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SH3GLB2 mRNA CTD PMID:17942748 Sh3glb2 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SH3GLB2 mRNA CTD PMID:17942748 Sh3glb2 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SH3GLB2 mRNA CTD PMID:17555576 Sh3glb2 Mouse 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO SH3GLB2 (Homo sapiens) 6480464 Metribolone results in increased expression of SH3GLB2 mRNA CTD PMID:17010196 Sh3glb2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SH3GLB2 mRNA CTD PMID:17942748 Sh3glb2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Sh3glb2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SH3GLB2 mRNA CTD PMID:32109520 and PMID:34747641 Sh3glb2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SH3GLB2 mRNA CTD PMID:21570461 Sh3glb2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SH3GLB2 mRNA CTD PMID:17942748 Sh3glb2 Mouse 2,6-dimethoxyphenol multiple interactions ISO SH3GLB2 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Sh3glb2 Mouse 3,3',5,5'-tetrabromobisphenol A increases expression ISO SH3GLB2 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of SH3GLB2 protein CTD PMID:31675489 Sh3glb2 Mouse 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SH3GLB2 mRNA CTD PMID:18648102 Sh3glb2 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Sh3glb2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SH3GLB2 mRNA CTD PMID:36041667 Sh3glb2 Mouse acrylamide decreases expression ISO SH3GLB2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SH3GLB2 mRNA CTD PMID:32763439 Sh3glb2 Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SH3GLB2 mRNA CTD PMID:19770486 Sh3glb2 Mouse aristolochic acid A decreases expression ISO SH3GLB2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SH3GLB2 mRNA and aristolochic acid I results in decreased expression of SH3GLB2 protein CTD PMID:33212167 Sh3glb2 Mouse bisphenol A decreases expression ISO Sh3glb2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SH3GLB2 mRNA CTD PMID:25181051 Sh3glb2 Mouse bisphenol A multiple interactions ISO Sh3glb2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SH3GLB2 mRNA CTD PMID:36041667 Sh3glb2 Mouse bisphenol A decreases expression ISO SH3GLB2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SH3GLB2 protein CTD PMID:31675489 Sh3glb2 Mouse bisphenol F multiple interactions ISO Sh3glb2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SH3GLB2 mRNA CTD PMID:36041667 Sh3glb2 Mouse bortezomib decreases expression ISO SH3GLB2 (Homo sapiens) 6480464 Bortezomib results in decreased expression of SH3GLB2 mRNA CTD PMID:20977926 Sh3glb2 Mouse caffeine decreases phosphorylation ISO SH3GLB2 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SH3GLB2 protein CTD PMID:35688186 Sh3glb2 Mouse chlordecone increases expression EXP 6480464 Chlordecone results in increased expression of SH3GLB2 mRNA CTD PMID:33711761 Sh3glb2 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of SH3GLB2 mRNA CTD PMID:32715474 Sh3glb2 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of SH3GLB2 mRNA CTD PMID:37019170 Sh3glb2 Mouse cisplatin increases expression ISO SH3GLB2 (Homo sapiens) 6480464 Cisplatin results in increased expression of SH3GLB2 mRNA CTD PMID:27392435 Sh3glb2 Mouse cisplatin multiple interactions ISO SH3GLB2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of SH3GLB2 mRNA CTD PMID:27392435 Sh3glb2 Mouse cobalt dichloride decreases expression ISO Sh3glb2 (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of SH3GLB2 mRNA CTD PMID:24386269 Sh3glb2 Mouse cobalt dichloride decreases expression ISO SH3GLB2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SH3GLB2 mRNA CTD PMID:19376846 Sh3glb2 Mouse cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of SH3GLB2 mRNA CTD PMID:19770486 Sh3glb2 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of SH3GLB2 mRNA CTD PMID:17361019 Sh3glb2 Mouse dorsomorphin multiple interactions ISO SH3GLB2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3GLB2 mRNA CTD PMID:27188386 Sh3glb2 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of SH3GLB2 mRNA CTD PMID:30319688 Sh3glb2 Mouse folic acid increases expression EXP 6480464 Folic Acid results in increased expression of SH3GLB2 mRNA CTD PMID:25629700 Sh3glb2 Mouse formaldehyde decreases expression ISO SH3GLB2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SH3GLB2 mRNA CTD PMID:27905399 Sh3glb2 Mouse furan increases methylation ISO Sh3glb2 (Rattus norvegicus) 6480464 furan results in increased methylation of SH3GLB2 gene CTD PMID:22079235 Sh3glb2 Mouse furfural multiple interactions ISO SH3GLB2 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Sh3glb2 Mouse gentamycin decreases expression ISO Sh3glb2 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of SH3GLB2 mRNA CTD PMID:33387578 Sh3glb2 Mouse hydrogen cyanide decreases expression EXP 6480464 Hydrogen Cyanide results in decreased expression of SH3GLB2 mRNA CTD PMID:33914522 Sh3glb2 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SH3GLB2 mRNA CTD PMID:36331819 Sh3glb2 Mouse ivermectin decreases expression ISO SH3GLB2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SH3GLB2 protein CTD PMID:32959892 Sh3glb2 Mouse mercury atom increases expression ISO SH3GLB2 (Homo sapiens) 6480464 Mercury results in increased expression of SH3GLB2 mRNA CTD PMID:16823088 Sh3glb2 Mouse mercury(0) increases expression ISO SH3GLB2 (Homo sapiens) 6480464 Mercury results in increased expression of SH3GLB2 mRNA CTD PMID:16823088 Sh3glb2 Mouse methotrexate affects response to substance ISO SH3GLB2 (Homo sapiens) 6480464 SH3GLB2 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Sh3glb2 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SH3GLB2 mRNA CTD PMID:35964746 Sh3glb2 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SH3GLB2 mRNA CTD PMID:17562736 Sh3glb2 Mouse paracetamol increases expression ISO SH3GLB2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SH3GLB2 mRNA CTD PMID:22230336 Sh3glb2 Mouse paraquat decreases expression ISO Sh3glb2 (Rattus norvegicus) 6480464 Paraquat results in decreased expression of SH3GLB2 mRNA CTD PMID:32680482 Sh3glb2 Mouse pentachlorophenol decreases expression EXP 6480464 Pentachlorophenol results in decreased expression of SH3GLB2 mRNA CTD PMID:23892564 Sh3glb2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SH3GLB2 mRNA CTD PMID:36331819 Sh3glb2 Mouse potassium cyanide increases expression EXP 6480464 Potassium Cyanide results in increased expression of SH3GLB2 mRNA CTD PMID:33914522 Sh3glb2 Mouse potassium dichromate increases expression ISO SH3GLB2 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of SH3GLB2 protein CTD PMID:23718831 Sh3glb2 Mouse SB 431542 multiple interactions ISO SH3GLB2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3GLB2 mRNA CTD PMID:27188386 Sh3glb2 Mouse sodium chloride multiple interactions ISO SH3GLB2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of SH3GLB2 protein more ... CTD PMID:38598786 Sh3glb2 Mouse sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of SH3GLB2 protein CTD PMID:28918527 Sh3glb2 Mouse sunitinib increases expression ISO SH3GLB2 (Homo sapiens) 6480464 Sunitinib results in increased expression of SH3GLB2 mRNA CTD PMID:31533062 Sh3glb2 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of SH3GLB2 mRNA CTD PMID:17555576 Sh3glb2 Mouse tetrachloromethane multiple interactions ISO Sh3glb2 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SH3GLB2 mRNA] CTD PMID:31150632 Sh3glb2 Mouse tetrachloromethane decreases expression ISO Sh3glb2 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of SH3GLB2 mRNA CTD PMID:31150632 Sh3glb2 Mouse thioacetamide decreases expression ISO Sh3glb2 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of SH3GLB2 mRNA CTD PMID:34492290 Sh3glb2 Mouse trichloroethene increases methylation ISO Sh3glb2 (Rattus norvegicus) 6480464 Trichloroethylene results in increased methylation of SH3GLB2 gene CTD PMID:27618143 Sh3glb2 Mouse triphenyl phosphate affects expression ISO SH3GLB2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SH3GLB2 mRNA CTD PMID:37042841 Sh3glb2 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of SH3GLB2 mRNA CTD PMID:17292431 Sh3glb2 Mouse valproic acid increases expression ISO SH3GLB2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SH3GLB2 mRNA CTD PMID:26272509 Sh3glb2 Mouse valproic acid multiple interactions ISO SH3GLB2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3GLB2 mRNA CTD PMID:27188386 Sh3glb2 Mouse valproic acid affects splicing ISO Sh3glb2 (Rattus norvegicus) 6480464 Valproic Acid affects the splicing of SH3GLB2 mRNA CTD PMID:29427782
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) 1,3-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) acrylamide (ISO) aflatoxin B1 (EXP) aristolochic acid A (ISO) bisphenol A (ISO) bisphenol F (ISO) bortezomib (ISO) caffeine (ISO) chlordecone (EXP) chlorpyrifos (EXP) cisplatin (ISO) cobalt dichloride (ISO) cyclosporin A (EXP) dibutyl phthalate (EXP) dorsomorphin (ISO) ethanol (EXP) folic acid (EXP) formaldehyde (ISO) furan (ISO) furfural (ISO) gentamycin (ISO) hydrogen cyanide (EXP) inulin (EXP) ivermectin (ISO) mercury atom (ISO) mercury(0) (ISO) methotrexate (ISO) nitrates (EXP) paracetamol (EXP,ISO) paraquat (ISO) pentachlorophenol (EXP) perfluorooctane-1-sulfonic acid (EXP) potassium cyanide (EXP) potassium dichromate (ISO) SB 431542 (ISO) sodium chloride (ISO) sodium fluoride (EXP) sunitinib (ISO) tamoxifen (EXP) tetrachloromethane (ISO) thioacetamide (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) valproic acid (EXP,ISO)
Sh3glb2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 30,234,789 - 30,249,380 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 30,234,821 - 30,249,349 (-) Ensembl GRCm39 Ensembl GRCm38 2 30,344,777 - 30,359,358 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 30,344,809 - 30,359,337 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 30,200,329 - 30,214,751 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 30,166,818 - 30,181,240 (-) NCBI MGSCv36 mm8 Celera 2 30,049,844 - 30,064,263 (-) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 21.6 NCBI
SH3GLB2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 129,007,036 - 129,028,331 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 129,007,036 - 129,028,331 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 131,769,315 - 131,790,610 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 130,810,134 - 130,830,400 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 128,849,867 - 128,870,133 NCBI Celera 9 102,422,625 - 102,442,892 (-) NCBI Celera Cytogenetic Map 9 q34.11 NCBI HuRef 9 101,377,634 - 101,397,864 (-) NCBI HuRef CHM1_1 9 131,921,341 - 131,941,566 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 141,210,470 - 141,231,788 (-) NCBI T2T-CHM13v2.0
Sh3glb2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 34,014,746 - 34,029,607 (-) NCBI GRCr8 mRatBN7.2 3 13,616,936 - 13,631,785 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 13,616,938 - 13,631,757 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 16,688,459 - 16,703,281 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 25,273,425 - 25,288,245 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 23,519,111 - 23,533,963 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 8,909,231 - 8,924,066 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 8,909,236 - 8,924,032 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 14,262,005 - 14,276,841 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 9,388,827 - 9,403,628 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 9,389,126 - 9,403,928 (-) NCBI Celera 3 8,383,439 - 8,398,287 (-) NCBI Celera Cytogenetic Map 3 p12 NCBI
Sh3glb2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955570 1,370,106 - 1,379,408 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955570 1,370,106 - 1,379,405 (-) NCBI ChiLan1.0 ChiLan1.0
SH3GLB2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 10,324,917 - 10,345,291 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 10,327,264 - 10,347,635 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 100,131,458 - 100,151,869 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 128,791,970 - 128,806,576 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 128,791,948 - 128,806,578 (-) Ensembl panpan1.1 panPan2
SH3GLB2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 54,636,610 - 54,656,724 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 54,635,870 - 54,656,720 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 53,832,165 - 53,852,272 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 55,557,623 - 55,577,763 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 55,557,506 - 55,577,761 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 54,319,184 - 54,339,329 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 54,631,394 - 54,651,531 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 54,724,706 - 54,744,838 (+) NCBI UU_Cfam_GSD_1.0
Sh3glb2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 196,695,178 - 196,715,246 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 16,463,666 - 16,474,969 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 16,463,705 - 16,474,699 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SH3GLB2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 269,312,825 - 269,332,344 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 269,313,788 - 269,332,351 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 303,329,912 - 303,348,485 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SH3GLB2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 9,131,906 - 9,149,674 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 9,131,929 - 9,149,032 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666096 408,001 - 426,673 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sh3glb2
.
Predicted Target Of
Count of predictions: 3198 Count of miRNA genes: 621 Interacting mature miRNAs: 791 Transcripts: ENSMUST00000028214, ENSMUST00000100215, ENSMUST00000113620, ENSMUST00000113621, ENSMUST00000128387, ENSMUST00000139963, ENSMUST00000140801, ENSMUST00000140899, ENSMUST00000142689, ENSMUST00000142720, ENSMUST00000146400, ENSMUST00000151145, ENSMUST00000151354, ENSMUST00000163668 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8552706 Cia24_m collagen induced arthritis QTL 24 (mouse) Not determined 2 24679115 33523172 Mouse 8552707 Cia23_m collagen induced arthritis QTL 23 (mouse) Not determined 2 12129537 66556453 Mouse 12904005 Cfq2_m conditioned fear QTL 2 (mouse) 2 27022642 56396228 Mouse 14746979 Manh51_m mandible shape 51 (mouse) 2 28961129 62961129 Mouse 1300624 Insq7_m insulin QTL 7 (mouse) Not determined 2 9384446 43384575 Mouse 8552705 Cia25_m collagen induced arthritis 25 (mouse) Not determined 2 24679115 33523172 Mouse 39128209 Lwq14_m liver weight QTL 14 (mouse) 2 20897778 118894840 Mouse 1558738 W6q1_m weight 6 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 26884438 Sklq12_m skull length QTL 12, 16 week (mouse) 2 24590012 54890012 Mouse 1301790 Pcfm1_m periosteal circumference and femur length 1 (mouse) Not determined 2 8236296 42236396 Mouse 1302174 Dssc2_m dextran sodium sulfate induced colitis QTL2 (mouse) Not determined 2 24224632 148700377 Mouse 4142130 Pgis2_m proteoglycan induced spondylitis 2 (mouse) Not determined 2 25308051 56971811 Mouse 1301980 Fcsa5_m femoral cross-sectional area 5 (mouse) Not determined 2 7679115 41679261 Mouse 1301376 Etohc1_m ethanol consumption 1 (mouse) Not determined 2 21129725 55129871 Mouse 1558915 W3q1_m weight 3 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 14746997 Mancz2_m mandible centroid size 2 (mouse) 2 28961129 62961129 Mouse 12792980 Fbmd1_m femoral bone mineral density 1, females only (mouse) 2 25034492 45034492 Mouse 1301769 Orgwq2_m organ weight QTL 2 (mouse) Not determined 2 3887126 93421651 Mouse 1301641 Sbmd2_m spinal bone mineral density 2 (mouse) Not determined 2 14214567 48214713 Mouse 1357454 Kidq1_m kidney weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 10755513 Amzn4_m anatomical modifier of Zfp423 4 (mouse) 2 9384446 43384575 Mouse 1558966 W10q9_m weight 10 weeks QTL 9 (mouse) Not determined 2 20897778 118894840 Mouse 4141854 T2dm2sa_m type 2 diabetes mellitus 2 in SMXA RI mice (mouse) Not determined 2 29307947 148374934 Mouse 13463470 Tubisq1_m tubulointerstitial injury severity, QTL 1 (mouse) 2 23689145 57689269 Mouse 1558899 Egq1_m early growth QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357681 Hrtq1_m heart weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357436 Splq1_m spleen weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357881 Estoq1_m embryo survival total QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1300577 Capsq1_m capsaicin sensitivity related QTL 1 (mouse) Not determined 2 27602060 84013384 Mouse 4141708 Pbwg1.2_m postnatal body weight growth 1.2 (mouse) Not determined 21129725 55129871 Mouse 10043876 Adip22_m adiposity 22 (mouse) Not determined 2 8308051 42308240 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000028214 ⟹ ENSMUSP00000028214
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,234,821 - 30,249,328 (-) Ensembl GRCm38.p6 Ensembl 2 30,344,809 - 30,359,316 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000100215 ⟹ ENSMUSP00000097788
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,234,821 - 30,249,252 (-) Ensembl GRCm38.p6 Ensembl 2 30,344,809 - 30,359,240 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000113620 ⟹ ENSMUSP00000109250
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,234,823 - 30,249,277 (-) Ensembl GRCm38.p6 Ensembl 2 30,344,811 - 30,359,265 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000113621 ⟹ ENSMUSP00000109251
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,234,823 - 30,249,344 (-) Ensembl GRCm38.p6 Ensembl 2 30,344,811 - 30,359,332 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000128387
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,235,832 - 30,249,349 (-) Ensembl GRCm38.p6 Ensembl 2 30,345,820 - 30,359,337 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000139963
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,239,752 - 30,249,272 (-) Ensembl GRCm38.p6 Ensembl 2 30,349,740 - 30,359,260 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000140801
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,238,080 - 30,245,377 (-) Ensembl GRCm38.p6 Ensembl 2 30,348,068 - 30,355,365 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000140899
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,238,102 - 30,244,892 (-) Ensembl GRCm38.p6 Ensembl 2 30,348,090 - 30,354,880 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000142689
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,235,153 - 30,236,113 (-) Ensembl GRCm38.p6 Ensembl 2 30,345,141 - 30,346,101 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000142720
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,236,120 - 30,237,599 (-) Ensembl GRCm38.p6 Ensembl 2 30,346,108 - 30,347,587 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000146400
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,235,898 - 30,237,668 (-) Ensembl GRCm38.p6 Ensembl 2 30,345,886 - 30,347,656 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000151145
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,239,495 - 30,249,257 (-) Ensembl GRCm38.p6 Ensembl 2 30,349,483 - 30,359,245 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000151354
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,235,147 - 30,249,317 (-) Ensembl GRCm38.p6 Ensembl 2 30,345,135 - 30,359,305 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000163668 ⟹ ENSMUSP00000131545
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 30,234,823 - 30,249,301 (-) Ensembl GRCm38.p6 Ensembl 2 30,344,811 - 30,359,289 (-) Ensembl
RefSeq Acc Id:
NM_001289709 ⟹ NP_001276638
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,789 - 30,249,328 (-) NCBI GRCm38 2 30,344,777 - 30,359,316 (-) NCBI Celera 2 30,049,812 - 30,064,383 (-) NCBI
Sequence:
GAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAA
hide sequence
RefSeq Acc Id:
NM_001289710 ⟹ NP_001276639
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,789 - 30,249,328 (-) NCBI GRCm38 2 30,344,777 - 30,359,316 (-) NCBI Celera 2 30,049,812 - 30,064,383 (-) NCBI
Sequence:
GAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAA
hide sequence
RefSeq Acc Id:
NM_001346806 ⟹ NP_001333735
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,789 - 30,249,328 (-) NCBI GRCm38 2 30,344,777 - 30,359,316 (-) NCBI
Sequence:
GAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAA
hide sequence
RefSeq Acc Id:
NM_001362888 ⟹ NP_001349817
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,789 - 30,249,328 (-) NCBI GRCm38 2 30,344,777 - 30,359,316 (-) NCBI
Sequence:
GAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAA
hide sequence
RefSeq Acc Id:
NM_139302 ⟹ NP_647463
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,789 - 30,249,328 (-) NCBI GRCm38 2 30,344,777 - 30,359,316 (-) NCBI MGSCv37 2 30,200,329 - 30,214,751 (-) RGD Celera 2 30,049,812 - 30,064,383 (-) NCBI cM Map 2 ENTREZGENE
Sequence:
GAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAA
hide sequence
RefSeq Acc Id:
NR_156413
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,789 - 30,249,328 (-) NCBI GRCm38 2 30,344,777 - 30,359,316 (-) NCBI
Sequence:
GAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCT
hide sequence
RefSeq Acc Id:
XM_006497937 ⟹ XP_006498000
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,370 (-) NCBI GRCm38 2 30,344,809 - 30,359,358 (-) NCBI
Sequence:
GCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCG
hide sequence
RefSeq Acc Id:
XM_006497938 ⟹ XP_006498001
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,370 (-) NCBI GRCm38 2 30,344,809 - 30,359,358 (-) NCBI
Sequence:
GCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCG
hide sequence
RefSeq Acc Id:
XM_006497939 ⟹ XP_006498002
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,370 (-) NCBI GRCm38 2 30,344,809 - 30,359,358 (-) NCBI
Sequence:
GCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGG
hide sequence
RefSeq Acc Id:
XM_006497941 ⟹ XP_006498004
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,360 (-) NCBI GRCm38 2 30,344,809 - 30,359,342 (-) NCBI
Sequence:
CGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCT
hide sequence
RefSeq Acc Id:
XM_006497942 ⟹ XP_006498005
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,317 (-) NCBI GRCm38 2 30,344,809 - 30,359,305 (-) NCBI
Sequence:
CAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAAGAAGCTGGCGT
hide sequence
RefSeq Acc Id:
XM_011239077 ⟹ XP_011237379
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,370 (-) NCBI GRCm38 2 30,344,809 - 30,359,358 (-) NCBI
Sequence:
GCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGG
hide sequence
RefSeq Acc Id:
XM_011239078 ⟹ XP_011237380
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,370 (-) NCBI GRCm38 2 30,344,809 - 30,359,358 (-) NCBI
Sequence:
GCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCG
hide sequence
RefSeq Acc Id:
XM_030249870 ⟹ XP_030105730
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,370 (-) NCBI GRCm38 2 30,344,809 - 30,359,358 (-) NCBI
Sequence:
GCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCG
hide sequence
RefSeq Acc Id:
XM_030249878 ⟹ XP_030105738
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,317 (-) NCBI GRCm38 2 30,344,809 - 30,359,305 (-) NCBI
Sequence:
CAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAAGAAGCTGGCGT
hide sequence
RefSeq Acc Id:
XM_030249882 ⟹ XP_030105742
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,317 (-) NCBI GRCm38 2 30,344,809 - 30,359,305 (-) NCBI
Sequence:
CAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAAGAAGCTGGCGT
hide sequence
RefSeq Acc Id:
XM_030249884 ⟹ XP_030105744
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,304 (-) NCBI GRCm38 2 30,344,809 - 30,359,292 (-) NCBI
Sequence:
GGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGGGCCGGCGTGGCGGCCCTGCGTACGGGCGCGCCATGGACTTCAACATGAAGAAGCTGGCGTCGGACGCGGGCAT
hide sequence
RefSeq Acc Id:
XM_036160832 ⟹ XP_036016725
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,380 (-) NCBI
Sequence:
GCCTGGCCCCGCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCT
hide sequence
RefSeq Acc Id:
XM_036160841 ⟹ XP_036016734
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,380 (-) NCBI
Sequence:
GCCTGGCCCCGCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCT
hide sequence
RefSeq Acc Id:
XM_036160842 ⟹ XP_036016735
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,313 (-) NCBI
Sequence:
CAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGG
hide sequence
RefSeq Acc Id:
XM_036160844 ⟹ XP_036016737
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,313 (-) NCBI
Sequence:
CAGCAGGTGGGCGGGGTGCGGCGGGGTGCGTGAGGCGGGGCGGGGGGCTGCCGGCTGCTCTGGG
hide sequence
RefSeq Acc Id:
XR_004939601
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 30,234,821 - 30,249,370 (-) NCBI
Sequence:
GCCCCGCGCTCGGCTCGGCTCGGCCGCGGACGCGCGCGCGCAGAGGGCGGGCGCAGGCAGCAGG
hide sequence
RefSeq Acc Id:
NP_647463 ⟸ NM_139302
- Peptide Label:
isoform 2
- UniProtKB:
B0LDS3 (UniProtKB/TrEMBL)
- Sequence:
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPSTPYGKTLIKVSEAEKRLGAA
hide sequence
RefSeq Acc Id:
XP_006498002 ⟸ XM_006497939
- Peptide Label:
isoform X3
- UniProtKB:
B0LDS3 (UniProtKB/TrEMBL)
- Sequence:
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLL
hide sequence
RefSeq Acc Id:
XP_006498001 ⟸ XM_006497938
- Peptide Label:
isoform X2
- UniProtKB:
B0LDS3 (UniProtKB/TrEMBL)
- Sequence:
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLL
hide sequence
RefSeq Acc Id:
XP_006498000 ⟸ XM_006497937
- Peptide Label:
isoform X1
- UniProtKB:
B0LDS3 (UniProtKB/TrEMBL)
- Sequence:
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLL
hide sequence
RefSeq Acc Id:
XP_006498005 ⟸ XM_006497942
- Peptide Label:
isoform X7
- Sequence:
MAEAASELGPSTPYGKTLIKVSEAEKRLGAAERDFIHTASLSFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATCEGDTVPDFQETRPRNYILSASASALWNDEVDKAEQEL
hide sequence
RefSeq Acc Id:
XP_006498004 ⟸ XM_006497941
- Peptide Label:
isoform X7
- Sequence:
MAEAASELGPSTPYGKTLIKVSEAEKRLGAAERDFIHTASLSFLTPLRNFLEGDWKTISKERRL
hide sequence
RefSeq Acc Id:
NP_001276639 ⟸ NM_001289710
- Peptide Label:
isoform 3
- UniProtKB:
A2AWI9 (UniProtKB/TrEMBL), B0LDS3 (UniProtKB/TrEMBL)
- Sequence:
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPSTPYGKTLIKVSEAEKRLGAA
hide sequence
RefSeq Acc Id:
NP_001276638 ⟸ NM_001289709
- Peptide Label:
isoform 1
- UniProtKB:
Q8K140 (UniProtKB/Swiss-Prot), Q3U824 (UniProtKB/Swiss-Prot), Q3U2J4 (UniProtKB/Swiss-Prot), Q3TIQ1 (UniProtKB/Swiss-Prot), Q91ZI7 (UniProtKB/Swiss-Prot), Q8R3V5 (UniProtKB/Swiss-Prot), B0LDS3 (UniProtKB/TrEMBL)
- Sequence:
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPSTPYGKTLIKVSEAEKRLGAA
hide sequence
RefSeq Acc Id:
XP_011237380 ⟸ XM_011239078
- Peptide Label:
isoform X5
- Sequence:
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLL
hide sequence
RefSeq Acc Id:
XP_011237379 ⟸ XM_011239077
- Peptide Label:
isoform X4
- Sequence:
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLL
hide sequence
RefSeq Acc Id:
NP_001349817 ⟸ NM_001362888
- Peptide Label:
isoform 5
- UniProtKB:
B0LDS3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001333735 ⟸ NM_001346806
- Peptide Label:
isoform 4
- UniProtKB:
A2AWI7 (UniProtKB/TrEMBL), B0LDS3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030105730 ⟸ XM_030249870
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_030105742 ⟸ XM_030249882
- Peptide Label:
isoform X10
RefSeq Acc Id:
XP_030105738 ⟸ XM_030249878
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_030105744 ⟸ XM_030249884
- Peptide Label:
isoform X12
Ensembl Acc Id:
ENSMUSP00000131545 ⟸ ENSMUST00000163668
Ensembl Acc Id:
ENSMUSP00000109251 ⟸ ENSMUST00000113621
Ensembl Acc Id:
ENSMUSP00000109250 ⟸ ENSMUST00000113620
Ensembl Acc Id:
ENSMUSP00000028214 ⟸ ENSMUST00000028214
Ensembl Acc Id:
ENSMUSP00000097788 ⟸ ENSMUST00000100215
RefSeq Acc Id:
XP_036016725 ⟸ XM_036160832
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_036016734 ⟸ XM_036160841
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_036016737 ⟸ XM_036160844
- Peptide Label:
isoform X13
RefSeq Acc Id:
XP_036016735 ⟸ XM_036160842
- Peptide Label:
isoform X12
RGD ID: 6832700 Promoter ID: MM_KWN:28522 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Brain, Kidney, Liver Transcripts: OTTMUST00000040764 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 30,201,196 - 30,202,447 (-) MPROMDB
RGD ID: 6832698 Promoter ID: MM_KWN:28523 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Brain Transcripts: OTTMUST00000040762, OTTMUST00000040763 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 30,202,846 - 30,203,897 (-) MPROMDB
RGD ID: 6832697 Promoter ID: MM_KWN:28525 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: OTTMUST00000040760, OTTMUST00000040761 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 30,210,186 - 30,210,686 (-) MPROMDB
RGD ID: 6847697 Promoter ID: MM_ACW:27918 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day4, Brain Transcripts: SH3GLB2.FSEP07 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 30,213,651 - 30,214,237 (-) MPROMDB
RGD ID: 6832699 Promoter ID: MM_KWN:28526 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, Kidney, Lung Transcripts: OTTMUST00000040709, OTTMUST00000040710, OTTMUST00000040712, OTTMUST00000040757, OTTMUST00000040758, OTTMUST00000040759, OTTMUST00000063695, UC008JCE.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 30,214,339 - 30,214,839 (-) MPROMDB
RGD ID: 6876896 Promoter ID: EPDNEW_M1899 Type: initiation region Name: Sh3glb2_1 Description: Mus musculus SH3-domain GRB2-like endophilin B2 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 30,359,310 - 30,359,370 EPDNEW
