Advanced Search (OLGA)

Gene: TXNDC5 (thioredoxin domain containing 5) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

TXNDC5

Name:

thioredoxin domain containing 5

RGD ID:

1313292

HGNC Page

HGNC:21073

Description:

Predicted to enable protein disulfide isomerase activity and protein-disulfide reductase activity. Predicted to be involved in protein folding. Located in extracellular exosome.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

EndoPDI; endoplasmic reticulum protein ERp46; endoplasmic reticulum resident protein 46; endothelial protein disulphide isomerase; ER protein 46; ERP46; FLJ21789; Hcc-2; HCC2; MGC3178; PDIA15; protein disulfide isomerase family A, member 15; STRF8; thioredoxin domain containing 5 (endoplasmic reticulum); thioredoxin domain-containing protein 5; thioredoxin related protein; thioredoxin-like protein p46; UNQ364

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Txndc5 (thioredoxin domain containing 5)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Txndc5 (thioredoxin domain containing 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Txndc5 (thioredoxin domain containing 5)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	TXNDC5 (thioredoxin domain containing 5)	NCBI	Ortholog
Canis lupus familiaris (dog):	TXNDC5 (thioredoxin domain containing 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Txndc5 (thioredoxin domain containing 5)	NCBI	Ortholog
Sus scrofa (pig):	TXNDC5 (thioredoxin domain containing 5)	HGNC	Ensembl, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):	TXNDC5 (thioredoxin domain containing 5)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Txndc5 (thioredoxin domain containing 5)	NCBI	Ortholog
Alliance orthologs ³
Mus musculus (house mouse):	Txndc5 (thioredoxin domain containing 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Txndc5 (thioredoxin domain containing 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	txndc5 (thioredoxin domain containing 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Drosophila melanogaster (fruit fly):	prtp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	EPS1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus laevis (African clawed frog):	txndc5.S	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	txndc5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus laevis (African clawed frog):	txndc5.L	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	7,881,517 - 7,910,788 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	7,881,517 - 7,910,788 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	7,881,750 - 7,911,021 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	7,826,749 - 8,009,596 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	7,826,752 - 7,856,040	NCBI
Celera	6	9,111,188 - 9,140,484 (-)	NCBI		Celera
Cytogenetic Map	6	p24.3	NCBI
HuRef	6	7,758,572 - 7,787,963 (-)	NCBI		HuRef
CHM1_1	6	7,883,601 - 7,913,171 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	7,750,266 - 7,779,537 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TXNDC5	Human	COVID-19		HEP		32716422	mRNA:decreased expression:antibody secreting B cells (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TXNDC5	Human	Experimental Arthritis		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:23326410
TXNDC5	Human	Neoplasm Metastasis		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17085005
TXNDC5	Human	Prostatic Neoplasms		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17199135
TXNDC5	Human	rheumatoid arthritis		EXP		11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:23326410

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TXNDC5	Human	(+)-schisandrin B	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TXNDC5 mRNA]	CTD	PMID:31150632
TXNDC5	Human	1,2-dimethylhydrazine	increases expression	ISO	Txndc5 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of TXNDC5 mRNA	CTD	PMID:22206623
TXNDC5	Human	1,2-dimethylhydrazine	multiple interactions	ISO	Txndc5 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of TXNDC5 mRNA]	CTD	PMID:22206623
TXNDC5	Human	17beta-estradiol	increases expression	ISO	Txndc5 (Mus musculus)	6480464	Estradiol results in increased expression of TXNDC5 mRNA	CTD	PMID:39298647
TXNDC5	Human	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of TXNDC5 mRNA	CTD	PMID:31614463
TXNDC5	Human	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	ISO	Txndc5 (Rattus norvegicus)	6480464	2 more ...	CTD	PMID:21394737
TXNDC5	Human	2,3',4,4',5-Pentachlorobiphenyl	increases expression	ISO	Txndc5 (Mus musculus)	6480464	2 more ...	CTD	PMID:31388691
TXNDC5	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Txndc5 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TXNDC5 mRNA	CTD	PMID:21570461
TXNDC5	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Txndc5 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin affects the expression of TXNDC5 mRNA	CTD	PMID:34747641
TXNDC5	Human	2,4,6-tribromophenol	increases expression	EXP		6480464	2 more ...	CTD	PMID:31675489
TXNDC5	Human	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Txndc5 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
TXNDC5	Human	2,6-dimethoxyphenol	multiple interactions	EXP		6480464	[Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of TXNDC5 protein	CTD	PMID:38598786
TXNDC5	Human	3,3',5,5'-tetrabromobisphenol A	increases expression	EXP		6480464	tetrabromobisphenol A results in increased expression of TXNDC5 protein	CTD	PMID:31675489
TXNDC5	Human	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of TXNDC5 mRNA	CTD	PMID:26251327
TXNDC5	Human	4,4'-diaminodiphenylmethane	increases expression	ISO	Txndc5 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of TXNDC5 mRNA	CTD	PMID:18648102
TXNDC5	Human	4,4'-sulfonyldiphenol	increases expression	ISO	Txndc5 (Mus musculus)	6480464	bisphenol S results in increased expression of TXNDC5 mRNA	CTD	PMID:39298647
TXNDC5	Human	4,4'-sulfonyldiphenol	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TXNDC5 mRNA	CTD	PMID:36041667
TXNDC5	Human	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of TXNDC5 protein	CTD	PMID:34186270
TXNDC5	Human	6-propyl-2-thiouracil	decreases expression	ISO	Txndc5 (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of TXNDC5 mRNA	CTD	PMID:36843608
TXNDC5	Human	aflatoxin B1	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Aflatoxin B1 results in decreased expression of TXNDC5 mRNA	CTD	PMID:19770486
TXNDC5	Human	aflatoxin B1	decreases expression	EXP		6480464	Aflatoxin B1 results in decreased expression of TXNDC5 mRNA	CTD	PMID:32234424
TXNDC5	Human	aflatoxin B1	increases methylation	EXP		6480464	Aflatoxin B1 results in increased methylation of TXNDC5 gene	CTD	PMID:27153756
TXNDC5	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of TXNDC5 mRNA	CTD	PMID:33167477
TXNDC5	Human	ampicillin	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TXNDC5 protein	CTD	PMID:30545405
TXNDC5	Human	antimycin A	increases expression	EXP		6480464	Antimycin A results in increased expression of TXNDC5 mRNA	CTD	PMID:33512557
TXNDC5	Human	arsane	multiple interactions	EXP		6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TXNDC5 mRNA	CTD	PMID:39836092
TXNDC5	Human	arsenic atom	multiple interactions	EXP		6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TXNDC5 mRNA	CTD	PMID:39836092
TXNDC5	Human	benzo[a]pyrene	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of TXNDC5 mRNA	CTD	PMID:19770486
TXNDC5	Human	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of TXNDC5 mRNA	CTD	PMID:32234424
TXNDC5	Human	bis(2-chloroethyl) sulfide	decreases expression	EXP		6480464	Mustard Gas results in decreased expression of TXNDC5 mRNA	CTD	PMID:25102026
TXNDC5	Human	bis(2-ethylhexyl) phthalate	increases expression	ISO	Txndc5 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of TXNDC5 mRNA	CTD	PMID:33754040
TXNDC5	Human	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of TXNDC5 mRNA	CTD	PMID:34319233
TXNDC5	Human	bisphenol A	decreases expression	ISO	Txndc5 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of TXNDC5 mRNA	CTD	PMID:34947998
TXNDC5	Human	bisphenol A	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TXNDC5 mRNA	CTD	PMID:36041667
TXNDC5	Human	bisphenol A	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	bisphenol A results in decreased expression of TXNDC5 protein	CTD	PMID:35999755
TXNDC5	Human	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TXNDC5 protein	CTD	PMID:34186270
TXNDC5	Human	bisphenol AF	increases expression	EXP		6480464	bisphenol AF results in increased expression of TXNDC5 protein	CTD	PMID:34186270
TXNDC5	Human	bisphenol F	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TXNDC5 mRNA	CTD	PMID:36041667
TXNDC5	Human	cadmium atom	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TXNDC5 mRNA	CTD	PMID:35301059
TXNDC5	Human	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TXNDC5 mRNA	CTD	PMID:35301059
TXNDC5	Human	carbon nanotube	affects expression	ISO	Txndc5 (Mus musculus)	6480464	Nanotubes and Carbon affects the expression of TXNDC5 protein	CTD	PMID:21135415
TXNDC5	Human	CGP 52608	multiple interactions	EXP		6480464	CGP 52608 promotes the reaction [RORA protein binds to TXNDC5 gene]	CTD	PMID:28238834
TXNDC5	Human	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of TXNDC5 mRNA	CTD	PMID:19320972
TXNDC5	Human	cobalt dichloride	multiple interactions	EXP		6480464	[cobaltous chloride results in decreased abundance of Oxygen] which results in increased expression of TXNDC5 mRNA and [cobaltous chloride results in decreased abundance of Oxygen] which results in increased expression of TXNDC5 protein	CTD	PMID:23326410
TXNDC5	Human	crocidolite asbestos	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of TXNDC5 mRNA	CTD	PMID:29279043
TXNDC5	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of TXNDC5 mRNA	CTD	PMID:20106945 and PMID:21163907
TXNDC5	Human	cyclosporin A	increases expression	ISO	Txndc5 (Mus musculus)	6480464	Cyclosporine results in increased expression of TXNDC5 mRNA	CTD	PMID:25270620
TXNDC5	Human	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of TXNDC5 protein	CTD	PMID:31675489
TXNDC5	Human	deguelin	increases expression	EXP		6480464	deguelin results in increased expression of TXNDC5 mRNA	CTD	PMID:33512557
TXNDC5	Human	dibutyl phthalate	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of TXNDC5 protein	CTD	PMID:34864091
TXNDC5	Human	dioxygen	multiple interactions	EXP		6480464	[cobaltous chloride results in decreased abundance of Oxygen] which results in increased expression of TXNDC5 mRNA and [cobaltous chloride results in decreased abundance of Oxygen] which results in increased expression of TXNDC5 protein	CTD	PMID:23326410
TXNDC5	Human	diuron	decreases expression	ISO	Txndc5 (Rattus norvegicus)	6480464	Diuron results in decreased expression of TXNDC5 mRNA	CTD	PMID:21551480
TXNDC5	Human	enzyme inhibitor	multiple interactions	EXP		6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TXNDC5 protein	CTD	PMID:23301498
TXNDC5	Human	fenpyroximate	increases expression	EXP		6480464	fenpyroximate results in increased expression of TXNDC5 mRNA	CTD	PMID:33512557
TXNDC5	Human	fenthion	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Fenthion results in decreased expression of TXNDC5 mRNA	CTD	PMID:34813904
TXNDC5	Human	folic acid	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Folic Acid results in decreased expression of TXNDC5 mRNA	CTD	PMID:25629700
TXNDC5	Human	folic acid	multiple interactions	ISO	Txndc5 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of TXNDC5 mRNA]	CTD	PMID:22206623
TXNDC5	Human	furfural	multiple interactions	EXP		6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of TXNDC5 protein	CTD	PMID:38598786
TXNDC5	Human	gentamycin	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TXNDC5 protein	CTD	PMID:30545405
TXNDC5	Human	gold atom	multiple interactions	ISO	Txndc5 (Mus musculus)	6480464	Gold analog results in decreased expression of and results in increased phosphorylation of TXNDC5 protein	CTD	PMID:24780912
TXNDC5	Human	gold(0)	multiple interactions	ISO	Txndc5 (Mus musculus)	6480464	Gold analog results in decreased expression of and results in increased phosphorylation of TXNDC5 protein	CTD	PMID:24780912
TXNDC5	Human	isoprenaline	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Isoproterenol results in decreased expression of TXNDC5 mRNA	CTD	PMID:20003209
TXNDC5	Human	ivermectin	decreases expression	EXP		6480464	Ivermectin results in decreased expression of TXNDC5 protein	CTD	PMID:32959892
TXNDC5	Human	leptomycin B	multiple interactions	EXP		6480464	1 and 1-bis(3'-indolyl)-1-(4-hydroxyphenyl)methane inhibits the reaction [leptomycin B results in increased expression of TXNDC5 mRNA]	CTD	PMID:24515801
TXNDC5	Human	leptomycin B	increases expression	EXP		6480464	leptomycin B results in increased expression of TXNDC5 mRNA	CTD	PMID:24515801
TXNDC5	Human	metronidazole	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TXNDC5 protein	CTD	PMID:30545405
TXNDC5	Human	neomycin	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TXNDC5 protein	CTD	PMID:30545405
TXNDC5	Human	nitrates	multiple interactions	ISO	Txndc5 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TXNDC5 mRNA	CTD	PMID:35964746
TXNDC5	Human	nitric oxide	multiple interactions	EXP		6480464	[NOS3 protein polymorphism results in decreased chemical synthesis of Nitric Oxide] which affects the expression of TXNDC5 protein	CTD	PMID:19320461
TXNDC5	Human	paracetamol	affects expression	ISO	Txndc5 (Mus musculus)	6480464	Acetaminophen affects the expression of TXNDC5 mRNA	CTD	PMID:17562736
TXNDC5	Human	paracetamol	decreases expression	ISO	Txndc5 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of TXNDC5 mRNA	CTD	PMID:33387578
TXNDC5	Human	paracetamol	increases expression	ISO	Txndc5 (Mus musculus)	6480464	Acetaminophen results in increased expression of TXNDC5 mRNA	CTD	PMID:29246445
TXNDC5	Human	paracetamol	multiple interactions	ISO	Txndc5 (Mus musculus)	6480464	PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of TXNDC5 mRNA]	CTD	PMID:29246445
TXNDC5	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Txndc5 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of TXNDC5 mRNA	CTD	PMID:36331819
TXNDC5	Human	pirinixic acid	increases expression	ISO	Txndc5 (Mus musculus)	6480464	pirinixic acid results in increased expression of TXNDC5 mRNA	CTD	PMID:18301758
TXNDC5	Human	pyrimidifen	increases expression	EXP		6480464	pyrimidifen results in increased expression of TXNDC5 mRNA	CTD	PMID:33512557
TXNDC5	Human	quinoline	decreases expression	EXP		6480464	quinoline analog results in decreased expression of TXNDC5 protein	CTD	PMID:18645022
TXNDC5	Human	SB 431542	multiple interactions	EXP		6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of TXNDC5 protein	CTD	PMID:37664457
TXNDC5	Human	sertraline	decreases expression	EXP		6480464	Sertraline results in decreased expression of TXNDC5 mRNA	CTD	PMID:24865413
TXNDC5	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of TXNDC5 mRNA	CTD	PMID:24516582 and PMID:38568856
TXNDC5	Human	sodium arsenite	multiple interactions	EXP		6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TXNDC5 mRNA	CTD	PMID:39836092
TXNDC5	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of TXNDC5 protein	CTD	PMID:20050688
TXNDC5	Human	sodium chloride	multiple interactions	EXP		6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of TXNDC5 protein more ...	CTD	PMID:38598786
TXNDC5	Human	tebufenpyrad	increases expression	EXP		6480464	4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of TXNDC5 mRNA	CTD	PMID:33512557
TXNDC5	Human	testosterone	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Testosterone deficiency results in decreased expression of TXNDC5 mRNA	CTD	PMID:33848595
TXNDC5	Human	tetrachloromethane	increases expression	ISO	Txndc5 (Rattus norvegicus)	6480464	Carbon Tetrachloride results in increased expression of TXNDC5 mRNA	CTD	PMID:31150632
TXNDC5	Human	tetrachloromethane	increases expression	ISO	Txndc5 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of TXNDC5 mRNA	CTD	PMID:31919559
TXNDC5	Human	tetrachloromethane	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TXNDC5 mRNA]	CTD	PMID:31150632
TXNDC5	Human	thifluzamide	increases expression	EXP		6480464	thifluzamide results in increased expression of TXNDC5 mRNA	CTD	PMID:33512557
TXNDC5	Human	titanium dioxide	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	titanium dioxide results in decreased expression of TXNDC5 mRNA	CTD	PMID:29264374
TXNDC5	Human	titanium dioxide	decreases methylation	ISO	Txndc5 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of TXNDC5 gene	CTD	PMID:35295148
TXNDC5	Human	trimellitic anhydride	increases expression	ISO	Txndc5 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of TXNDC5 mRNA	CTD	PMID:19042947
TXNDC5	Human	valproic acid	decreases expression	ISO	Txndc5 (Mus musculus)	6480464	Valproic Acid results in decreased expression of TXNDC5 mRNA	CTD	PMID:21427059
TXNDC5	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of TXNDC5 mRNA	CTD	PMID:25979313
TXNDC5	Human	vancomycin	multiple interactions	ISO	Txndc5 (Rattus norvegicus)	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TXNDC5 protein	CTD	PMID:30545405
TXNDC5	Human	zinc atom	increases expression	EXP		6480464	Zinc deficiency results in increased expression of TXNDC5 mRNA	CTD	PMID:22171008
TXNDC5	Human	zinc(0)	increases expression	EXP		6480464	Zinc deficiency results in increased expression of TXNDC5 mRNA	CTD	PMID:22171008

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TXNDC5	Human	negative regulation of apoptotic process	involved_in	TAS		150520179	PMID:16130169	UniProt	PMID:16130169
TXNDC5	Human	protein folding	involved_in	IBA	PANTHER:PTN005231188 more ...	150520179		GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TXNDC5	Human	azurophil granule lumen	located_in	TAS		150520179		Reactome	Reactome:R-HSA-6798751
TXNDC5	Human	cytoplasm	located_in	IEA	ARBA:ARBA00026971	150520179		UniProt	GO_REF:0000117
TXNDC5	Human	endomembrane system	located_in	IEA	ARBA:ARBA00028953	150520179		UniProt	GO_REF:0000117
TXNDC5	Human	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	150520179		UniProt	GO_REF:0000043
TXNDC5	Human	endoplasmic reticulum	is_active_in	IBA	FB:FBgn0030329 more ...	150520179		GO_Central	GO_REF:0000033
TXNDC5	Human	endoplasmic reticulum	located_in	TAS		150520179	PMID:16130169	UniProt	PMID:16130169
TXNDC5	Human	endoplasmic reticulum lumen	located_in	IEA	UniProtKB:Q91W90 and ensembl:ENSMUSP00000041839	150520179		Ensembl	GO_REF:0000107
TXNDC5	Human	endoplasmic reticulum lumen	located_in	ISS	UniProtKB:Q91W90	150520179		UniProt	GO_REF:0000024
TXNDC5	Human	endoplasmic reticulum lumen	located_in	IEA	UniProtKB-SubCell:SL-0096	150520179		UniProt	GO_REF:0000044
TXNDC5	Human	extracellular exosome	located_in	HDA		150520179	PMID:19199708 and PMID:23533145	UniProt	PMID:19199708 and PMID:23533145
TXNDC5	Human	extracellular region	located_in	TAS		150520179		Reactome	Reactome:R-HSA-6798751
TXNDC5	Human	intracellular membrane-bounded organelle	located_in	IEA	ARBA:ARBA00029085	150520179		UniProt	GO_REF:0000117
TXNDC5	Human	lysosomal lumen	located_in	TAS		150520179		Reactome	Reactome:R-HSA-429815

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TXNDC5	Human	isomerase activity	enables	IEA	UniProtKB-KW:KW-0413	150520179		UniProt	GO_REF:0000043
TXNDC5	Human	oxidoreductase activity	enables	IEA	UniProtKB-KW:KW-0560	150520179		UniProt	GO_REF:0000043
TXNDC5	Human	protein binding	enables	IPI	UniProtKB:Q9UHD9	150520179	PMID:32296183	IntAct	PMID:32296183
TXNDC5	Human	protein binding	enables	IPI	UniProtKB:O08807	150520179	PMID:24462249	IntAct	PMID:24462249
TXNDC5	Human	protein binding	enables	IPI	UniProtKB:O43597 more ...	150520179	PMID:25416956	IntAct	PMID:25416956
TXNDC5	Human	protein binding	enables	IPI	UniProtKB:Q13162	150520179	PMID:21057456	IntAct	PMID:21057456
TXNDC5	Human	protein disulfide isomerase activity	enables	IEA	InterPro:IPR005788	150520179		InterPro	GO_REF:0000002
TXNDC5	Human	protein disulfide isomerase activity	enables	IBA	MGI:2145316 more ...	150520179		GO_Central	GO_REF:0000033
TXNDC5	Human	protein disulfide isomerase activity	enables	ISS	UniProtKB:Q91W90	150520179		UniProt	GO_REF:0000024
TXNDC5	Human	protein disulfide isomerase activity	enables	IEA	UniProtKB:Q91W90 and ensembl:ENSMUSP00000041839	150520179		Ensembl	GO_REF:0000107
TXNDC5	Human	protein-disulfide reductase activity	enables	IEA	UniProtKB:Q91W90 and ensembl:ENSMUSP00000041839	150520179		Ensembl	GO_REF:0000107
TXNDC5	Human	protein-disulfide reductase activity	enables	ISS	UniProtKB:Q91W90	150520179		UniProt	GO_REF:0000024

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
TXNDC5	Human	Endoplasmic Reticulum-associated degradation pathway		IEA		6907045		KEGG	hsa:04141

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Immune cell profiling of COVID-19 patients in the recovery stage by single-cell sequencing.	Wen W, etal., Cell Discov. 2020 May 4;6:31. doi: 10.1038/s41421-020-0168-9. eCollection 2020.

PMID:11031247	PMID:11252894	PMID:12477932	PMID:12878160	PMID:12930873	PMID:12963716	PMID:12975309	PMID:14574404	PMID:14702039	PMID:14744259	PMID:15489334	PMID:16130169
PMID:16574106	PMID:17895523	PMID:19199708	PMID:19367581	PMID:19694819	PMID:19834535	PMID:19887585	PMID:19906073	PMID:20074551	PMID:20157732	PMID:21057456	PMID:21145461
PMID:21461837	PMID:21516116	PMID:21617212	PMID:21801346	PMID:21832049	PMID:21873635	PMID:22190034	PMID:22505402	PMID:22810586	PMID:22863883	PMID:22939629	PMID:23245351
PMID:23326410	PMID:23376096	PMID:23533145	PMID:23713588	PMID:23752268	PMID:24023338	PMID:24100949	PMID:24103565	PMID:24457600	PMID:24462249	PMID:24594673	PMID:24711643
PMID:25416956	PMID:25500540	PMID:25609649	PMID:25921289	PMID:26186194	PMID:26344197	PMID:26496610	PMID:26638075	PMID:26810069	PMID:27173435	PMID:27375898	PMID:27432908
PMID:27576135	PMID:27684187	PMID:27777122	PMID:27880917	PMID:28514442	PMID:28515276	PMID:28581483	PMID:28603283	PMID:28604976	PMID:28655764	PMID:28675297	PMID:29131315
PMID:29180619	PMID:29229926	PMID:29247155	PMID:29507755	PMID:29535165	PMID:29749460	PMID:29784879	PMID:29845934	PMID:29892012	PMID:30021884	PMID:30522366	PMID:30575818
PMID:30884312	PMID:30948266	PMID:31056421	PMID:31091453	PMID:31182584	PMID:31324722	PMID:31331361	PMID:31343991	PMID:31586073	PMID:32149426	PMID:32203420	PMID:32296183
PMID:32344865	PMID:32457219	PMID:32572027	PMID:32687490	PMID:32707033	PMID:32780723	PMID:32788342	PMID:32838362	PMID:32848143	PMID:32913203	PMID:32941674	PMID:32989298
PMID:32994395	PMID:33022573	PMID:33187986	PMID:33239621	PMID:33545068	PMID:33957083	PMID:33961781	PMID:34079125	PMID:34189442	PMID:34349018	PMID:34535262	PMID:34606982
PMID:34709727	PMID:34728620	PMID:35256949	PMID:35271311	PMID:35337019	PMID:35384245	PMID:35446349	PMID:35562734	PMID:35696571	PMID:35819319	PMID:35831314	PMID:35934705
PMID:35944360	PMID:36050716	PMID:36106447	PMID:36215168	PMID:36217030	PMID:36225252	PMID:36244648	PMID:36273042	PMID:36424410	PMID:36517590	PMID:36543142	PMID:36604567
PMID:36762613	PMID:37071682	PMID:37223481	PMID:37249651	PMID:37689310	PMID:38113892	PMID:38548704	PMID:38569033	PMID:38629066	PMID:39468006

TXNDC5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	7,881,517 - 7,910,788 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	7,881,517 - 7,910,788 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	7,881,750 - 7,911,021 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	7,826,749 - 8,009,596 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	7,826,752 - 7,856,040	NCBI
Celera	6	9,111,188 - 9,140,484 (-)	NCBI		Celera
Cytogenetic Map	6	p24.3	NCBI
HuRef	6	7,758,572 - 7,787,963 (-)	NCBI		HuRef
CHM1_1	6	7,883,601 - 7,913,171 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	7,750,266 - 7,779,537 (-)	NCBI		T2T-CHM13v2.0

Txndc5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	38,684,242 - 38,712,800 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	38,684,055 - 38,712,800 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	38,500,266 - 38,528,824 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	38,500,079 - 38,528,824 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	38,592,144 - 38,620,329 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	38,507,741 - 38,535,926 (-)	NCBI		MGSCv36	mm8
Celera	13	39,616,452 - 39,644,639 (-)	NCBI		Celera
Cytogenetic Map	13	A3.3	NCBI
cM Map	13	18.27	NCBI

Txndc5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	26,495,467 - 26,523,608 (+)	NCBI		GRCr8
mRatBN7.2	17	26,289,880 - 26,318,025 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	26,289,880 - 26,318,025 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	26,147,696 - 26,175,806 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	27,751,281 - 27,779,392 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	26,096,561 - 26,124,693 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	26,925,828 - 26,953,981 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	26,925,828 - 26,953,970 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	28,841,031 - 28,869,184 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	32,350,902 - 32,378,321 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	32,353,771 - 32,381,879 (+)	NCBI
Celera	17	25,925,724 - 25,953,865 (+)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

Txndc5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955465	6,033,968 - 6,053,769 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955465	6,034,006 - 6,053,779 (+)	NCBI	ChiLan1.0	ChiLan1.0

TXNDC5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	22,522,351 - 22,551,966 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	18,519,349 - 18,548,868 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	7,720,141 - 7,749,672 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	8,001,831 - 8,025,284 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	8,001,831 - 8,027,408 (-)	Ensembl	panpan1.1		panPan2

TXNDC5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	7,834,135 - 7,854,836 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	7,834,331 - 7,854,852 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	7,841,150 - 7,865,571 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	7,916,645 - 7,942,933 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	35	7,773,396 - 7,798,132 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	7,799,357 - 7,825,378 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	9,132,754 - 9,158,894 (-)	NCBI		UU_Cfam_GSD_1.0

Txndc5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	16,410,650 - 16,438,740 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936534	4,679,631 - 4,706,309 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936534	4,679,636 - 4,706,682 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TXNDC5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	5,210,064 - 5,236,812 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	5,210,192 - 5,236,857 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	5,314,558 - 5,323,063 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TXNDC5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	64,250,319 - 64,278,102 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	64,250,359 - 64,281,195 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	7,873,712 - 7,902,752 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Txndc5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	17,694,205 - 17,742,726 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624756	17,611,990 - 17,742,726 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in TXNDC5
53 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 6p25.3-24.1(chr6:164360-13339881)x3	copy number gain	See cases [RCV000134022]	Chr6:164360..13339881 [GRCh38] Chr6:164360..13340113 [GRCh37] Chr6:109360..13448092 [NCBI36] Chr6:6p25.3-24.1	pathogenic
GRCh38/hg38 6p25.3-24.3(chr6:163083-9525496)x3	copy number gain	See cases [RCV000136567]	Chr6:163083..9525496 [GRCh38] Chr6:163083..9525729 [GRCh37] Chr6:108083..9633715 [NCBI36] Chr6:6p25.3-24.3	pathogenic
GRCh38/hg38 6p25.2-24.1(chr6:4068792-13267799)x1	copy number loss	See cases [RCV000136132]	Chr6:4068792..13267799 [GRCh38] Chr6:4069026..13268031 [GRCh37] Chr6:4014025..13376010 [NCBI36] Chr6:6p25.2-24.1	pathogenic
GRCh38/hg38 6p25.3-22.3(chr6:152634-15732163)x3	copy number gain	See cases [RCV000138121]	Chr6:152634..15732163 [GRCh38] Chr6:152634..15732394 [GRCh37] Chr6:97634..15840373 [NCBI36] Chr6:6p25.3-22.3	likely benign
GRCh38/hg38 6p25.2-21.33(chr6:3224310-30657190)x3	copy number gain	See cases [RCV000138956]	Chr6:3224310..30657190 [GRCh38] Chr6:3224544..30624967 [GRCh37] Chr6:3169543..30732946 [NCBI36] Chr6:6p25.2-21.33	pathogenic
GRCh38/hg38 6p25.3-22.3(chr6:155807-17058414)x3	copy number gain	See cases [RCV000140307]	Chr6:155807..17058414 [GRCh38] Chr6:155807..17058645 [GRCh37] Chr6:100807..17166624 [NCBI36] Chr6:6p25.3-22.3	pathogenic
GRCh38/hg38 6p25.3-24.2(chr6:156974-11550817)x3	copy number gain	See cases [RCV000142295]	Chr6:156974..11550817 [GRCh38] Chr6:156974..11551050 [GRCh37] Chr6:101974..11659036 [NCBI36] Chr6:6p25.3-24.2	likely pathogenic
GRCh38/hg38 6p25.2-22.3(chr6:2862640-16697788)x1	copy number loss	See cases [RCV000142435]	Chr6:2862640..16697788 [GRCh38] Chr6:2862874..16698019 [GRCh37] Chr6:2807873..16805998 [NCBI36] Chr6:6p25.2-22.3	pathogenic
GRCh38/hg38 6p25.3-23(chr6:152634-14417003)x3	copy number gain	See cases [RCV000143334]	Chr6:152634..14417003 [GRCh38] Chr6:152634..14417234 [GRCh37] Chr6:97634..14525213 [NCBI36] Chr6:6p25.3-23	pathogenic
GRCh38/hg38 6p25.3-24.1(chr6:156974-13081201)x3	copy number gain	See cases [RCV000143698]	Chr6:156974..13081201 [GRCh38] Chr6:156974..13081433 [GRCh37] Chr6:101974..13189419 [NCBI36] Chr6:6p25.3-24.1	likely pathogenic
GRCh38/hg38 6p25.3-23(chr6:156974-13855925)x1	copy number loss	See cases [RCV000143782]	Chr6:156974..13855925 [GRCh38] Chr6:156974..13856156 [GRCh37] Chr6:101974..13964135 [NCBI36] Chr6:6p25.3-23	pathogenic
GRCh38/hg38 6p25.3-12.3(chr6:156974-46789291)x3	copy number gain	See cases [RCV000143497]	Chr6:156974..46789291 [GRCh38] Chr6:156974..46757028 [GRCh37] Chr6:101974..46864987 [NCBI36] Chr6:6p25.3-12.3	pathogenic
GRCh38/hg38 6p25.3-22.3(chr6:106431-18360595)x3	copy number gain	See cases [RCV000051869]	Chr6:106431..18360595 [GRCh38] Chr6:106431..18360826 [GRCh37] Chr6:51431..18468805 [NCBI36] Chr6:6p25.3-22.3	pathogenic
GRCh38/hg38 6p25.3-23(chr6:389423-13474956)x3	copy number gain	See cases [RCV000051896]	Chr6:389423..13474956 [GRCh38] Chr6:389423..13475188 [GRCh37] Chr6:334423..13583167 [NCBI36] Chr6:6p25.3-23	pathogenic
GRCh38/hg38 6p25.3-24.3(chr6:165675-9036034)x1	copy number loss	See cases [RCV000052165]	Chr6:165675..9036034 [GRCh38] Chr6:165675..9036267 [GRCh37] Chr6:110675..8981266 [NCBI36] Chr6:6p25.3-24.3	pathogenic
GRCh38/hg38 6p25.1-24.3(chr6:4427090-8391140)x1	copy number loss	See cases [RCV000052177]	Chr6:4427090..8391140 [GRCh38] Chr6:4427324..8391373 [GRCh37] Chr6:4372323..8336372 [NCBI36] Chr6:6p25.1-24.3	pathogenic
GRCh38/hg38 6p25.1-24.3(chr6:5925989-8749319)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052178]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052178]\|See cases [RCV000052178]	Chr6:5925989..8749319 [GRCh38] Chr6:5926222..8749552 [GRCh37] Chr6:5871221..8694551 [NCBI36] Chr6:6p25.1-24.3	pathogenic
NM_030810.5(TXNDC5):c.958G>A (p.Asp320Asn)	single nucleotide variant	not specified [RCV004295315]	Chr6:7888710 [GRCh38] Chr6:7888943 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.232G>A (p.Ala78Thr)	single nucleotide variant	not specified [RCV004299359]	Chr6:7910545 [GRCh38] Chr6:7910778 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.1208G>A (p.Arg403Gln)	single nucleotide variant	not provided [RCV000961047]	Chr6:7883235 [GRCh38] Chr6:7883468 [GRCh37] Chr6:6p24.3	benign
NM_030810.5(TXNDC5):c.1147G>C (p.Ala383Pro)	single nucleotide variant	not specified [RCV004301121]	Chr6:7884388 [GRCh38] Chr6:7884621 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.189G>T (p.Lys63Asn)	single nucleotide variant	not specified [RCV004289314]	Chr6:7910588 [GRCh38] Chr6:7910821 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.952G>A (p.Glu318Lys)	single nucleotide variant	not specified [RCV004295314]	Chr6:7888716 [GRCh38] Chr6:7888949 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.62T>A (p.Leu21Gln)	single nucleotide variant	not specified [RCV004230899]	Chr6:7910715 [GRCh38] Chr6:7910948 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.95G>A (p.Gly32Glu)	single nucleotide variant	not specified [RCV004139457]	Chr6:7910682 [GRCh38] Chr6:7910915 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.74T>A (p.Leu25Gln)	single nucleotide variant	not specified [RCV004230902]	Chr6:7910703 [GRCh38] Chr6:7910936 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.29C>G (p.Pro10Arg)	single nucleotide variant	not specified [RCV004191897]	Chr6:7910748 [GRCh38] Chr6:7910981 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.1264C>T (p.Arg422Cys)	single nucleotide variant	not specified [RCV004208664]	Chr6:7883179 [GRCh38] Chr6:7883412 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.71T>A (p.Leu24Gln)	single nucleotide variant	not specified [RCV004112179]	Chr6:7910706 [GRCh38] Chr6:7910939 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.4C>T (p.Pro2Ser)	single nucleotide variant	not specified [RCV004177060]	Chr6:7910773 [GRCh38] Chr6:7911006 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.65T>A (p.Leu22Gln)	single nucleotide variant	not specified [RCV004230900]	Chr6:7910712 [GRCh38] Chr6:7910945 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.179C>T (p.Pro60Leu)	single nucleotide variant	not specified [RCV004184433]	Chr6:7910598 [GRCh38] Chr6:7910831 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.712G>A (p.Glu238Lys)	single nucleotide variant	not specified [RCV004197706]	Chr6:7891641 [GRCh38] Chr6:7891874 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.19C>G (p.Arg7Gly)	single nucleotide variant	not specified [RCV004138569]	Chr6:7910758 [GRCh38] Chr6:7910991 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.16G>A (p.Gly6Arg)	single nucleotide variant	not specified [RCV004233929]	Chr6:7910761 [GRCh38] Chr6:7910994 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.281G>A (p.Arg94Gln)	single nucleotide variant	not specified [RCV004181790]	Chr6:7904706 [GRCh38] Chr6:7904939 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.1253A>G (p.Asp418Gly)	single nucleotide variant	not specified [RCV004244042]	Chr6:7883190 [GRCh38] Chr6:7883423 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.750C>G (p.His250Gln)	single nucleotide variant	not specified [RCV004150264]	Chr6:7889564 [GRCh38] Chr6:7889797 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.313A>C (p.Lys105Gln)	single nucleotide variant	not specified [RCV004111987]	Chr6:7904674 [GRCh38] Chr6:7904907 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.295T>C (p.Trp99Arg)	single nucleotide variant	not specified [RCV004144669]	Chr6:7904692 [GRCh38] Chr6:7904925 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.1278C>A (p.Ser426Arg)	single nucleotide variant	not specified [RCV004176215]	Chr6:7883165 [GRCh38] Chr6:7883398 [GRCh37] Chr6:6p24.3	likely benign
NM_030810.5(TXNDC5):c.22C>T (p.Leu8Phe)	single nucleotide variant	not specified [RCV004076618]	Chr6:7910755 [GRCh38] Chr6:7910988 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.68T>A (p.Leu23Gln)	single nucleotide variant	not specified [RCV004230901]	Chr6:7910709 [GRCh38] Chr6:7910942 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.305T>G (p.Leu102Arg)	single nucleotide variant	not specified [RCV004266211]	Chr6:7904682 [GRCh38] Chr6:7904915 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.875C>T (p.Ser292Leu)	single nucleotide variant	not specified [RCV004338495]	Chr6:7888793 [GRCh38] Chr6:7889026 [GRCh37] Chr6:6p24.3	likely benign
NM_030810.5(TXNDC5):c.932C>T (p.Pro311Leu)	single nucleotide variant	not specified [RCV004358811]	Chr6:7888736 [GRCh38] Chr6:7888969 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.142G>C (p.Gly48Arg)	single nucleotide variant	not specified [RCV004342246]	Chr6:7910635 [GRCh38] Chr6:7910868 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.455A>G (p.Gln152Arg)	single nucleotide variant	not specified [RCV004348672]	Chr6:7899640 [GRCh38] Chr6:7899873 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.375C>T (p.Ser125=)	single nucleotide variant	not provided [RCV003436487]	Chr6:7904612 [GRCh38] Chr6:7904845 [GRCh37] Chr6:6p24.3	likely benign
NM_030810.5(TXNDC5):c.1070C>G (p.Ala357Gly)	single nucleotide variant	not specified [RCV004484033]	Chr6:7884465 [GRCh38] Chr6:7884698 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.17G>A (p.Gly6Glu)	single nucleotide variant	not specified [RCV004484034]	Chr6:7910760 [GRCh38] Chr6:7910993 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.271C>G (p.His91Asp)	single nucleotide variant	not specified [RCV004484035]	Chr6:7904716 [GRCh38] Chr6:7904949 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.464G>A (p.Arg155Gln)	single nucleotide variant	not specified [RCV004484036]	Chr6:7899631 [GRCh38] Chr6:7899864 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.547A>G (p.Ser183Gly)	single nucleotide variant	not specified [RCV004484037]	Chr6:7895175 [GRCh38] Chr6:7895408 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.644C>T (p.Pro215Leu)	single nucleotide variant	not specified [RCV004484039]	Chr6:7891709 [GRCh38] Chr6:7891942 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.713A>T (p.Glu238Val)	single nucleotide variant	not specified [RCV004484040]	Chr6:7891640 [GRCh38] Chr6:7891873 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.955G>T (p.Ala319Ser)	single nucleotide variant	not specified [RCV004484041]	Chr6:7888713 [GRCh38] Chr6:7888946 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.619G>A (p.Asp207Asn)	single nucleotide variant	not specified [RCV004677620]	Chr6:7891734 [GRCh38] Chr6:7891967 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.946G>A (p.Glu316Lys)	single nucleotide variant	not specified [RCV004677621]	Chr6:7888722 [GRCh38] Chr6:7888955 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.1193C>T (p.Thr398Met)	single nucleotide variant	not specified [RCV004677622]	Chr6:7883250 [GRCh38] Chr6:7883483 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.507C>G (p.Asn169Lys)	single nucleotide variant	not specified [RCV004677623]	Chr6:7899588 [GRCh38] Chr6:7899821 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.1198T>G (p.Leu400Val)	single nucleotide variant	not specified [RCV004677624]	Chr6:7883245 [GRCh38] Chr6:7883478 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.808G>T (p.Asp270Tyr)	single nucleotide variant	TXNDC5-related condition [RCV004758978]	Chr6:7889506 [GRCh38] Chr6:7889739 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.1105C>G (p.Pro369Ala)	single nucleotide variant	not specified [RCV004881383]	Chr6:7884430 [GRCh38] Chr6:7884663 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.148C>T (p.Pro50Ser)	single nucleotide variant	not specified [RCV004881384]	Chr6:7910629 [GRCh38] Chr6:7910862 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.376G>A (p.Asp126Asn)	single nucleotide variant	not specified [RCV004881385]	Chr6:7904611 [GRCh38] Chr6:7904844 [GRCh37] Chr6:6p24.3	uncertain significance
NM_030810.5(TXNDC5):c.1132G>A (p.Glu378Lys)	single nucleotide variant	not specified [RCV004881386]	Chr6:7884403 [GRCh38] Chr6:7884636 [GRCh37] Chr6:6p24.3	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	3091
Count of miRNA genes:	788
Interacting mature miRNAs:	883
Transcripts:	ENST00000379757, ENST00000460138, ENST00000469459, ENST00000473453, ENST00000475802, ENST00000539054
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597476412	GWAS1572486_H	blood protein measurement QTL GWAS1572486 (human)		3e-21	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	6	7883235	7883236	Human
2289408	BW324_H	Body weight QTL 324 (human)	3.15	0.0001	Body fat amount		6	1	20803913	Human
597362425	GWAS1458499_H	blood protein measurement QTL GWAS1458499 (human)		2e-12	blood protein amount (VT:0005416)	blood protein measurement (CMO:0000028)	6	7899503	7899504	Human
1643418	BW282_H	Body Weight QTL 282 (human)	2.07	0.001	Body weight		6	1	19321359	Human
597445019	GWAS1541093_H	thioredoxin domain-containing protein 5 measurement QTL GWAS1541093 (human)		5e-27	thioredoxin domain-containing protein 5 measurement		6	7883235	7883236	Human
1643377	BW325_H	Body weight QTL 325 (human)	2.32	0.0005	Body fat amount		6	6911960	32911960	Human
1643569	GLUCO21_H	Glucose level QTL 21 (human)		0.021	Glucose level	non-insulin-dependent	6	6911960	32911960	Human
1298458	BW9_H	Body weight QTL 9 (human)	2.7	0.0002	Body fat amount		6	6911960	32911960	Human
2289320	BW390_H	Body weight QTL 390 (human)	2.13		Body weight	BMI	6	1	19321359	Human
597322484	GWAS1418558_H	level of thioredoxin domain-containing protein 5 in blood serum QTL GWAS1418558 (human)		3e-12	level of thioredoxin domain-containing protein 5 in blood serum		6	7881919	7881920	Human
1358854	MULTSCL4_H	Multiple sclerosis susceptibility QTL 4 (human)			Multiple sclerosis susceptibility		6	6911960	32911960	Human
597176844	GWAS1272918_H	thioredoxin domain-containing protein 5 measurement QTL GWAS1272918 (human)		1e-45	thioredoxin domain-containing protein 5 measurement		6	7887106	7887111	Human
2289435	BMD4_H	Bone mineral density QTL 4 (human)	3.15	0.0001	Bone mineral density		6	1	20803913	Human
2292824	PRSTS5_H	Prostate tumor susceptibility QTL 5 (human)			Prostate tumor susceptibility		6	1	19232373	Human
597432294	GWAS1528368_H	protein measurement QTL GWAS1528368 (human)		2e-15	protein measurement		6	7883235	7883236	Human
596978377	GWAS1097896_H	body height QTL GWAS1097896 (human)		6e-11	body height		6	7881698	7881699	Human
597510880	GWAS1606954_H	level of thioredoxin domain-containing protein 5 in blood serum QTL GWAS1606954 (human)		8e-20	level of thioredoxin domain-containing protein 5 in blood serum		6	7883235	7883236	Human
1643495	BW291_H	Body Weight QTL 291 (human)	2.13		Body weight	BMI	6	1	19321359	Human
1643399	BMD5_H	Bone mineral density QTL 5 (human)	2.32	0.0005	Bone mineral density		6	6911960	32911960	Human

A002L04

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	7,881,912 - 7,882,028	UniSTS	GRCh37
Build 36	6	7,826,911 - 7,827,027	RGD	NCBI36
Celera	6	9,111,350 - 9,111,466	RGD
Cytogenetic Map	6	p24.3	UniSTS
Cytogenetic Map	6	p24-p23	UniSTS
Cytogenetic Map	6	p	UniSTS
HuRef	6	7,758,990 - 7,759,106	UniSTS
GeneMap99-GB4 RH Map	6	40.68	UniSTS
GeneMap99-GB4 RH Map	6	43.85	UniSTS
Whitehead-RH Map	6	65.7	UniSTS

WI-13193

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	7,881,799 - 7,881,902	UniSTS	GRCh37
Build 36	6	7,826,798 - 7,826,901	RGD	NCBI36
Celera	6	9,111,237 - 9,111,340	RGD
Cytogenetic Map	6	p	UniSTS
Cytogenetic Map	6	p24.3	UniSTS
Cytogenetic Map	6	p24-p23	UniSTS
HuRef	6	7,758,888 - 7,758,980	UniSTS
GeneMap99-GB4 RH Map	6	40.68	UniSTS
Whitehead-RH Map	6	65.8	UniSTS

RH26506

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	7,890,998 - 7,891,181	UniSTS	GRCh37
Build 36	6	7,835,997 - 7,836,180	RGD	NCBI36
Celera	6	9,120,439 - 9,120,622	RGD
Cytogenetic Map	6	p24.3	UniSTS
HuRef	6	7,768,075 - 7,768,258	UniSTS

NIB594

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	7,881,839 - 7,882,061	UniSTS	GRCh37
Build 36	6	7,826,838 - 7,827,060	RGD	NCBI36
Celera	6	9,111,277 - 9,111,499	RGD
Cytogenetic Map	6	p24-p23	UniSTS
Cytogenetic Map	6	p24.3	UniSTS
Stanford-G3 RH Map	6	247.0	UniSTS
GeneMap99-G3 RH Map	6	247.0	UniSTS

RH46813

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	7,891,006 - 7,891,131	UniSTS	GRCh37
Build 36	6	7,836,005 - 7,836,130	RGD	NCBI36
Celera	6	9,120,447 - 9,120,572	RGD
Cytogenetic Map	6	p24.3	UniSTS
HuRef	6	7,768,083 - 7,768,208	UniSTS
GeneMap99-GB4 RH Map	6	42.91	UniSTS
NCBI RH Map	6	105.1	UniSTS

AL021859

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	7,884,815 - 7,884,972	UniSTS	GRCh37
Build 36	6	7,829,814 - 7,829,971	RGD	NCBI36
Celera	6	9,114,253 - 9,114,410	RGD
Cytogenetic Map	6	p24.3	UniSTS
HuRef	6	7,761,889 - 7,762,046	UniSTS

SHGC-33534

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	7,890,904 - 7,891,028	UniSTS	GRCh37
Build 36	6	7,835,903 - 7,836,027	RGD	NCBI36
Celera	6	9,120,345 - 9,120,469	RGD
Cytogenetic Map	6	p24.3	UniSTS
HuRef	6	7,767,981 - 7,768,105	UniSTS
Stanford-G3 RH Map	6	235.0	UniSTS
GeneMap99-GB4 RH Map	6	43.85	UniSTS
Whitehead-RH Map	6	61.3	UniSTS
NCBI RH Map	6	112.7	UniSTS
GeneMap99-G3 RH Map	6	235.0	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2250	4971	1726	2351	6	624	1948	465	2270	7297	6463	53	3731	1	852	1744	1617	174	1


RefSeq Transcripts	NM_001145549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_030810	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ440721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK025006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK075291	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK098089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK315598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL133541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL833008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL834423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY326464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY358646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC001199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF726049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ181185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU855393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GQ891501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000379757 ⟹ ENSP00000369081

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	7,881,517 - 7,910,788 (-)	Ensembl

Ensembl Acc Id:

ENST00000460138

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	7,881,517 - 7,889,445 (-)	Ensembl

Ensembl Acc Id:

ENST00000469459

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	7,895,155 - 7,900,242 (-)	Ensembl

Ensembl Acc Id:

ENST00000473453 ⟹ ENSP00000420784

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	7,883,144 - 7,910,077 (-)	Ensembl

Ensembl Acc Id:

ENST00000475802

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	7,883,155 - 7,888,961 (-)	Ensembl

RefSeq Acc Id:

NM_001145549 ⟹ NP_001139021

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	7,881,517 - 7,910,077 (-)	NCBI
GRCh37	6	7,881,483 - 7,911,047 (-)	ENTREZGENE
HuRef	6	7,758,572 - 7,787,963 (-)	ENTREZGENE
CHM1_1	6	7,883,601 - 7,912,434 (-)	NCBI
T2T-CHM13v2.0	6	7,750,266 - 7,778,826 (-)	NCBI

Sequence:

show sequence

AATTCAACCGCCTCTTGCACCTCGGCACCGAGGGAGGGGAAGGTGGGGTCGTCGCCCTTTCGGGCAGCCGGGAGTCCAAATGTCACCCCGCGGTCCCTGCCCAGCGCCCCAAACTTCCTGTGCCGGCC
GGACGCGCGGCCTGCCCGTGGGCCACGTGCACTCACCAGAGCGGCCTTGCTGCTGCCGCGGCCACCGGGGTCGGCTGGGACAGACTGCGGGCACGTCCCCTTCCAGAGGCTTTAACTGAAAAATAGAA
CCCAGGAAGGTGTGGACACTGCCAGCGGCTGCAGCCGACTTGGAATGACCTGGGAGACAAATACAACAGCATGGAAGATGCCAAAGTCTATGTGGCTAAAGTGGACTGCACGGCCCACTCCGACGTGT
GCTCCGCCCAGGGGGTGCGAGGATACCCCACCTTAAAGCTTTTCAAGCCAGGCCAAGAAGCTGTGAAGTACCAGGGTCCTCGGGACTTCCAGACACTGGAAAACTGGATGCTGCAGACACTGAACGAG
GAGCCAGTGACACCAGAGCCGGAAGTGGAACCGCCCAGTGCCCCCGAGCTCAAGCAAGGGCTGTATGAGCTCTCAGCAAGCAACTTTGAGCTGCACGTTGCACAAGGCGACCACTTTATCAAGTTCTT
CGCTCCGTGGTGTGGTCACTGCAAAGCCCTGGCTCCAACCTGGGAGCAGCTGGCTCTGGGCCTTGAACATTCCGAAACTGTCAAGATTGGCAAGGTTGATTGTACACAGCACTATGAACTCTGCTCCG
GAAACCAGGTTCGTGGCTATCCCACTCTTCTCTGGTTCCGAGATGGGAAAAAGGTGGATCAGTACAAGGGAAAGCGGGATTTGGAGTCACTGAGGGAGTACGTGGAGTCGCAGCTGCAGCGCACAGAG
ACTGGAGCGACGGAGACCGTCACGCCCTCAGAGGCCCCGGTGCTGGCAGCTGAGCCCGAGGCTGACAAGGGCACTGTGTTGGCACTCACTGAAAATAACTTCGATGACACCATTGCAGAAGGAATAAC
CTTCATCAAGTTTTATGCTCCATGGTGTGGTCATTGTAAGACTCTGGCTCCTACTTGGGAGGAACTCTCTAAAAAGGAATTCCCTGGTCTGGCGGGGGTCAAGATCGCCGAAGTAGACTGCACTGCTG
AACGGAATATCTGCAGCAAGTATTCGGTACGAGGCTACCCCACGTTATTGCTTTTCCGAGGAGGGAAGAAAGTCAGTGAGCACAGTGGAGGCAGAGACCTTGACTCGTTACACCGCTTTGTCCTGAGC
CAAGCGAAAGACGAACTTTAGGAACACAGTTGGAGGTCACCTCTCCTGCCCAGCTCCCGCACCCTGCGTTTAGGAGTTCAGTCCCACAGAGGCCACTGGGTTCCCAGTGGTGGCTGTTCAGAAAGCAG
AACATACTAAGCGTGAGGTATCTTCTTTGTGTGTGTGTTTTCCAAGCCAACACACTCTACAGATTCTTTATTAAGTTAAGTTTCTCTAAGTAAATGTGTAACTCATGGTCACTGTGTAAACATTTTCA
GTGGCGATATATCCCCTTTGACCTTCTCTTGATGAAATTTACATGGTTTCCTTTGAGACTAAAATAGCGTTGAGGGAAATGAAATTGCTGGACTATTTGTGGCTCCTGAGTTGAGTGATTTTGGTGAA
AGAAAGCACATCCAAAGCATAGTTTACCTGCCCACGAGTTCTGGAAAGGTGGCCTTGTGGCAGTATTGACGTTCCTCTGATCTTAAGGTCACAGTTGACTCAATACTGTGTTGGTCCGTAGCATGGAG
CAGATTGAAATGCAAAAACCCACACCTCTGGAAGATACCTTCACGGCCGCTGCTGGAGCTTCTGTTGCTGTGAATACTTCTCTCAGTGTGAGAGGTTAGCCGTGATGAAAGCAGCGTTACTTCTGACC
GTGCCTGAGTAAGAGAATGCTGATGCCATAACTTTATGTGTCGATACTTGTCAAATCAGTTACTGTTCAGGGGATCCTTCTGTTTCTCACGGGGTGAAACATGTCTTTAGTTCCTCATGTTAACACGA
AGCCAGAGCCCACATGAACTGTTGGATGTCTTCCTTAGAAAGGGTAGGCATGGAAAATTCCACGAGGCTCATTCTCAGTATCTCATTAACTCATTGAAAGATTCCAGTTGTATTTGTCACCTGGGGTG
ACAAGACCAGACAGGCTTTCCCAGGCCTGGGTATCCAGGGAGGCTCTGCAGCCCTGCTGAAGGGCCCTAACTAGAGTTCTAGAGTTTCTGATTCTGTTTCTCAGTAGTCCTTTTAGAGGCTTGCTATA
CTTGGTCTGCTTCAAGGAGGTCGACCTTCTAATGTATGAAGAATGGGATGCATTTGATCTCAAGACCAAAGACAGATGTCAGTGGGCTGCTCTGGCCCTGGTGTGCACGGCTGTGGCAGCTGTTGATG
CCAGTGTCCTCTAACTCATGCTGTCCTTGTGATTAAACACCTCTATCTCCCTTGGGAATAAGCACATACAGGCTTAAGCTCTAAGATAGATAGGTGTTTGTCCTTTTACCATCGAGCTACTTCCCATA
ATAACCACTTTGCATCCAACACTCTTCACCCACCTCCCATACGCAAGGGGATGTGGATACTTGGCCCAAAGTAACTGGTGGTAGGAATCTTAGAAACAAGACCACTTATACTGTCTGTCTGAGGCAGA
AGATAACAGCAGCATCTCGACCAGCCTCTGCCTTAAAGGAAATCTTTATTAATCACGTATGGTTCACAGATAATTCTTTTTTTAAAAAAACCCAACCTCCTAGAGAAGCACAACTGTCAAGAGTCTTG
TACACACAACTTCAGCTTTGCATCACGAGTCTTGTATTCCAAGAAAATCAAAGTGGTACAATTTGTTTGTTTACACTATGATACTTTCTAAATAAACTCTTTTTTTTTAAAA

hide sequence

RefSeq Acc Id:

NM_030810 ⟹ NP_110437

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	7,881,517 - 7,910,788 (-)	NCBI
GRCh37	6	7,881,483 - 7,911,047 (-)	NCBI
Build 36	6	7,826,749 - 7,856,040 (-)	NCBI Archive
HuRef	6	7,758,572 - 7,787,963 (-)	ENTREZGENE
CHM1_1	6	7,883,601 - 7,913,171 (-)	NCBI
T2T-CHM13v2.0	6	7,750,266 - 7,779,537 (-)	NCBI

Sequence:

show sequence

AGCCCCGCCGCGATGCCCGCGCGCCCAGGACGCCTCCTCCCGCTGCTGGCCCGGCCGGCGGCCCTGACTGCGCTGCTGCTGCTGCTGCTGGGCCATGGCGGCGGCGGGCGCTGGGGCGCCCGGGCCCA
GGAGGCGGCGGCGGCGGCGGCGGACGGGCCCCCCGCGGCAGACGGCGAGGACGGACAGGACCCGCACAGCAAGCACCTGTACACGGCCGACATGTTCACGCACGGGATCCAGAGCGCCGCGCACTTCG
TCATGTTCTTCGCGCCCTGGTGTGGACACTGCCAGCGGCTGCAGCCGACTTGGAATGACCTGGGAGACAAATACAACAGCATGGAAGATGCCAAAGTCTATGTGGCTAAAGTGGACTGCACGGCCCAC
TCCGACGTGTGCTCCGCCCAGGGGGTGCGAGGATACCCCACCTTAAAGCTTTTCAAGCCAGGCCAAGAAGCTGTGAAGTACCAGGGTCCTCGGGACTTCCAGACACTGGAAAACTGGATGCTGCAGAC
ACTGAACGAGGAGCCAGTGACACCAGAGCCGGAAGTGGAACCGCCCAGTGCCCCCGAGCTCAAGCAAGGGCTGTATGAGCTCTCAGCAAGCAACTTTGAGCTGCACGTTGCACAAGGCGACCACTTTA
TCAAGTTCTTCGCTCCGTGGTGTGGTCACTGCAAAGCCCTGGCTCCAACCTGGGAGCAGCTGGCTCTGGGCCTTGAACATTCCGAAACTGTCAAGATTGGCAAGGTTGATTGTACACAGCACTATGAA
CTCTGCTCCGGAAACCAGGTTCGTGGCTATCCCACTCTTCTCTGGTTCCGAGATGGGAAAAAGGTGGATCAGTACAAGGGAAAGCGGGATTTGGAGTCACTGAGGGAGTACGTGGAGTCGCAGCTGCA
GCGCACAGAGACTGGAGCGACGGAGACCGTCACGCCCTCAGAGGCCCCGGTGCTGGCAGCTGAGCCCGAGGCTGACAAGGGCACTGTGTTGGCACTCACTGAAAATAACTTCGATGACACCATTGCAG
AAGGAATAACCTTCATCAAGTTTTATGCTCCATGGTGTGGTCATTGTAAGACTCTGGCTCCTACTTGGGAGGAACTCTCTAAAAAGGAATTCCCTGGTCTGGCGGGGGTCAAGATCGCCGAAGTAGAC
TGCACTGCTGAACGGAATATCTGCAGCAAGTATTCGGTACGAGGCTACCCCACGTTATTGCTTTTCCGAGGAGGGAAGAAAGTCAGTGAGCACAGTGGAGGCAGAGACCTTGACTCGTTACACCGCTT
TGTCCTGAGCCAAGCGAAAGACGAACTTTAGGAACACAGTTGGAGGTCACCTCTCCTGCCCAGCTCCCGCACCCTGCGTTTAGGAGTTCAGTCCCACAGAGGCCACTGGGTTCCCAGTGGTGGCTGTT
CAGAAAGCAGAACATACTAAGCGTGAGGTATCTTCTTTGTGTGTGTGTTTTCCAAGCCAACACACTCTACAGATTCTTTATTAAGTTAAGTTTCTCTAAGTAAATGTGTAACTCATGGTCACTGTGTA
AACATTTTCAGTGGCGATATATCCCCTTTGACCTTCTCTTGATGAAATTTACATGGTTTCCTTTGAGACTAAAATAGCGTTGAGGGAAATGAAATTGCTGGACTATTTGTGGCTCCTGAGTTGAGTGA
TTTTGGTGAAAGAAAGCACATCCAAAGCATAGTTTACCTGCCCACGAGTTCTGGAAAGGTGGCCTTGTGGCAGTATTGACGTTCCTCTGATCTTAAGGTCACAGTTGACTCAATACTGTGTTGGTCCG
TAGCATGGAGCAGATTGAAATGCAAAAACCCACACCTCTGGAAGATACCTTCACGGCCGCTGCTGGAGCTTCTGTTGCTGTGAATACTTCTCTCAGTGTGAGAGGTTAGCCGTGATGAAAGCAGCGTT
ACTTCTGACCGTGCCTGAGTAAGAGAATGCTGATGCCATAACTTTATGTGTCGATACTTGTCAAATCAGTTACTGTTCAGGGGATCCTTCTGTTTCTCACGGGGTGAAACATGTCTTTAGTTCCTCAT
GTTAACACGAAGCCAGAGCCCACATGAACTGTTGGATGTCTTCCTTAGAAAGGGTAGGCATGGAAAATTCCACGAGGCTCATTCTCAGTATCTCATTAACTCATTGAAAGATTCCAGTTGTATTTGTC
ACCTGGGGTGACAAGACCAGACAGGCTTTCCCAGGCCTGGGTATCCAGGGAGGCTCTGCAGCCCTGCTGAAGGGCCCTAACTAGAGTTCTAGAGTTTCTGATTCTGTTTCTCAGTAGTCCTTTTAGAG
GCTTGCTATACTTGGTCTGCTTCAAGGAGGTCGACCTTCTAATGTATGAAGAATGGGATGCATTTGATCTCAAGACCAAAGACAGATGTCAGTGGGCTGCTCTGGCCCTGGTGTGCACGGCTGTGGCA
GCTGTTGATGCCAGTGTCCTCTAACTCATGCTGTCCTTGTGATTAAACACCTCTATCTCCCTTGGGAATAAGCACATACAGGCTTAAGCTCTAAGATAGATAGGTGTTTGTCCTTTTACCATCGAGCT
ACTTCCCATAATAACCACTTTGCATCCAACACTCTTCACCCACCTCCCATACGCAAGGGGATGTGGATACTTGGCCCAAAGTAACTGGTGGTAGGAATCTTAGAAACAAGACCACTTATACTGTCTGT
CTGAGGCAGAAGATAACAGCAGCATCTCGACCAGCCTCTGCCTTAAAGGAAATCTTTATTAATCACGTATGGTTCACAGATAATTCTTTTTTTAAAAAAACCCAACCTCCTAGAGAAGCACAACTGTC
AAGAGTCTTGTACACACAACTTCAGCTTTGCATCACGAGTCTTGTATTCCAAGAAAATCAAAGTGGTACAATTTGTTTGTTTACACTATGATACTTTCTAAATAAACTCTTTTTTTTTAAAA

hide sequence


Protein RefSeqs	NP_001139021	(Get FASTA)	NCBI Sequence Viewer
	NP_110437	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH01199	(Get FASTA)	NCBI Sequence Viewer
	AAQ89009	(Get FASTA)	NCBI Sequence Viewer
	AAR99514	(Get FASTA)	NCBI Sequence Viewer
	ADO22363	(Get FASTA)	NCBI Sequence Viewer
	BAC11526	(Get FASTA)	NCBI Sequence Viewer
	BAG37969	(Get FASTA)	NCBI Sequence Viewer
	CAD29430	(Get FASTA)	NCBI Sequence Viewer
	CAD39084	(Get FASTA)	NCBI Sequence Viewer
	CAH56286	(Get FASTA)	NCBI Sequence Viewer
	EAW55220	(Get FASTA)	NCBI Sequence Viewer
	EAW55221	(Get FASTA)	NCBI Sequence Viewer
	EAW55222	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000369081
	ENSP00000369081.4
	ENSP00000420784
	ENSP00000420784.1
GenBank Protein	Q8NBS9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_110437 ⟸ NM_030810
- Peptide Label:	isoform 1 precursor
- UniProtKB:	Q8TCT2 (UniProtKB/Swiss-Prot), Q8ND33 (UniProtKB/Swiss-Prot), Q5TCQ0 (UniProtKB/Swiss-Prot), B2RDM2 (UniProtKB/Swiss-Prot), Q9BVH9 (UniProtKB/Swiss-Prot), Q8NBS9 (UniProtKB/Swiss-Prot), Q658S9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVC SAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSG NQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAE RNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL hide sequence

RefSeq Acc Id:	NP_001139021 ⟸ NM_001145549
- Peptide Label:	isoform 3
- UniProtKB:	A0A024QZV0 (UniProtKB/TrEMBL), Q86UY0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEP VTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQA KDEL hide sequence

Ensembl Acc Id:

ENSP00000369081 ⟸ ENST00000379757

Ensembl Acc Id:

ENSP00000420784 ⟸ ENST00000473453

Protein Domains

Thioredoxin

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8NBS9-F1-model_v2	AlphaFold	Q8NBS9	1-432	view protein structure

RGD ID:

6804904

Promoter ID:

HG_KWN:52257

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

HeLa_S3, Lymphoblastoid

Transcripts:

OTTHUMT00000039793

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	7,833,991 - 7,835,642 (-)	MPROMDB

RGD ID:

6804905

Promoter ID:

HG_KWN:52258

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562, Lymphoblastoid, NB4

Transcripts:

OTTHUMT00000039792, UC010JNZ.1, UC010JOA.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	7,855,166 - 7,856,782 (-)	MPROMDB

RGD ID:

6871988

Promoter ID:

EPDNEW_H9159

Type:

initiation region

Name:

TXNDC5_4

Description:

thioredoxin domain containing 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9161 EPDNEW_H9160 EPDNEW_H9162

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	7,884,415 - 7,884,475	EPDNEW

RGD ID:

6871994

Promoter ID:

EPDNEW_H9160

Type:

initiation region

Name:

TXNDC5_3

Description:

thioredoxin domain containing 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9159 EPDNEW_H9161 EPDNEW_H9162

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	7,895,104 - 7,895,164	EPDNEW

RGD ID:

6871992

Promoter ID:

EPDNEW_H9161

Type:

initiation region

Name:

TXNDC5_2

Description:

thioredoxin domain containing 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9159 EPDNEW_H9160 EPDNEW_H9162

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	7,904,590 - 7,904,650	EPDNEW

RGD ID:

6871996

Promoter ID:

EPDNEW_H9162

Type:

initiation region

Name:

TXNDC5_1

Description:

thioredoxin domain containing 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H9159 EPDNEW_H9161 EPDNEW_H9160

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	7,910,788 - 7,910,848	EPDNEW

RGD ID:

6804483

Promoter ID:

HG_KWN:52262

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

ENST00000397456, ENST00000397457, NM_201280, UC003MXW.1, UC010JOB.1, UC010JOC.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	8,009,354 - 8,009,854 (-)	MPROMDB

Database	Acc Id	Source(s)
COSMIC	TXNDC5	COSMIC
Ensembl Genes	ENSG00000239264	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000379757	ENTREZGENE
	ENST00000379757.9	UniProtKB/Swiss-Prot
	ENST00000473453	ENTREZGENE
	ENST00000473453.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Glutaredoxin	UniProtKB/Swiss-Prot
GTEx	ENSG00000239264	GTEx
HGNC ID	HGNC:21073	ENTREZGENE
Human Proteome Map	TXNDC5	Human Proteome Map
InterPro	Disulphide_isomerase	UniProtKB/Swiss-Prot
	PDI	UniProtKB/Swiss-Prot
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot
	Thioredoxin_CS	UniProtKB/Swiss-Prot
	Thioredoxin_domain	UniProtKB/Swiss-Prot
KEGG Report	hsa:81567	UniProtKB/Swiss-Prot
NCBI Gene	81567	ENTREZGENE
OMIM	616412	OMIM
PANTHER	PROTEIN DISULFIDE-ISOMERASE C17H9.14C-RELATED	UniProtKB/Swiss-Prot
	THIOREDOXIN DOMAIN-CONTAINING PROTEIN 5	UniProtKB/Swiss-Prot
Pfam	Thioredoxin	UniProtKB/Swiss-Prot
PharmGKB	PA134992492	PharmGKB
PRINTS	THIOREDOXIN	UniProtKB/Swiss-Prot
PROSITE	ER_TARGET	UniProtKB/Swiss-Prot
	THIOREDOXIN_1	UniProtKB/Swiss-Prot
	THIOREDOXIN_2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52833	UniProtKB/Swiss-Prot
UniProt	A0A024QZV0	ENTREZGENE, UniProtKB/TrEMBL
	B2RDM2	ENTREZGENE
	Q5TCQ0	ENTREZGENE
	Q658S9	ENTREZGENE, UniProtKB/TrEMBL
	Q86UY0	ENTREZGENE, UniProtKB/TrEMBL
	Q8NBS9	ENTREZGENE
	Q8ND33	ENTREZGENE
	Q8TCT2	ENTREZGENE
	Q9BVH9	ENTREZGENE
	TXND5_HUMAN	UniProtKB/Swiss-Prot
UniProt Secondary	B2RDM2	UniProtKB/Swiss-Prot
	Q5TCQ0	UniProtKB/Swiss-Prot
	Q8ND33	UniProtKB/Swiss-Prot
	Q8TCT2	UniProtKB/Swiss-Prot
	Q9BVH9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-12	TXNDC5	thioredoxin domain containing 5		thioredoxin domain containing 5 (endoplasmic reticulum)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)