Symbol:
Kifap3
Name:
kinesin-associated protein 3
RGD ID:
1313073
MGI Page
MGI
Description:
Enables intraciliary transport particle B binding activity. Involved in anterograde dendritic transport of neurotransmitter receptor complex. Acts upstream of or within several processes, including negative regulation of apoptotic process; negative regulation of neuroblast proliferation; and positive regulation of calcium-dependent cell-cell adhesion. Located in several cellular components, including cytoskeleton; periciliary membrane compartment; and photoreceptor cell cilium. Part of kinesin II complex. Is active in glutamatergic synapse and postsynapse. Is expressed in embryo mesenchyme; heart; nervous system; and sensory organ. Orthologous to human KIFAP3 (kinesin associated protein 3).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
KA; KAP-3; KAP3; SMAP; Smg GDS
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KIFAP3 (kinesin associated protein 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Kifap3 (kinesin-associated protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KIFAP3 (kinesin associated protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KIFAP3 (kinesin associated protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kifap3 (kinesin associated protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KIFAP3 (kinesin associated protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KIFAP3 (kinesin associated protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kifap3 (kinesin associated protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Kifap3 (kinesin-associated protein 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KIFAP3 (kinesin associated protein 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kifap3a (kinesin-associated protein 3a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
kifap3b (kinesin-associated protein 3b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|ZFIN)
Caenorhabditis elegans (roundworm):
kap-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Kap3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kifap3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 163,589,711 - 163,744,676 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 163,607,152 - 163,744,678 (+) Ensembl GRCm39 Ensembl GRCm38 1 163,762,138 - 163,917,107 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 163,779,583 - 163,917,109 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 165,709,810 - 165,847,231 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 165,616,354 - 165,753,775 (+) NCBI MGSCv36 mm8 Celera 1 166,219,175 - 166,357,571 (+) NCBI Celera Cytogenetic Map 1 H2.1 NCBI cM Map 1 71.08 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kifap3 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1313072 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of KIFAP3 mRNA CTD PMID:22079256 Kifap3 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of KIFAP3 mRNA CTD PMID:22206623 Kifap3 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KIFAP3 mRNA CTD PMID:22206623 Kifap3 Mouse 2,2',5,5'-tetrachlorobiphenyl increases expression ISO RGD:1305191 6480464 2,5,2',5'-tetrachlorobiphenyl results in increased expression of KIFAP3 mRNA CTD PMID:23829299 Kifap3 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of KIFAP3 mRNA CTD PMID:21570461|PMID:24680724 Kifap3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1305191 6480464 Tetrachlorodibenzodioxin results in decreased expression of KIFAP3 mRNA CTD PMID:33387578 Kifap3 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1305191 6480464 Tetrachlorodibenzodioxin results in increased expression of KIFAP3 mRNA CTD PMID:34747641 Kifap3 Mouse 2,4-dinitrotoluene affects expression ISO RGD:1305191 6480464 2,4-dinitrotoluene affects the expression of KIFAP3 mRNA CTD PMID:21346803 Kifap3 Mouse 4-amino-2,6-dinitrotoluene affects expression ISO RGD:1305191 6480464 4-amino-2,6-dinitrotoluene affects the expression of KIFAP3 mRNA CTD PMID:21346803 Kifap3 Mouse 5-aza-2'-deoxycytidine affects expression ISO RGD:1313072 6480464 Decitabine affects the expression of KIFAP3 mRNA CTD PMID:23300844 Kifap3 Mouse 6-propyl-2-thiouracil increases expression ISO RGD:1305191 6480464 Propylthiouracil results in increased expression of KIFAP3 mRNA CTD PMID:36843608 Kifap3 Mouse aflatoxin B1 decreases methylation ISO RGD:1313072 6480464 Aflatoxin B1 results in decreased methylation of KIFAP3 gene CTD PMID:27153756 Kifap3 Mouse all-trans-retinoic acid increases expression ISO RGD:1313072 6480464 Tretinoin results in increased expression of KIFAP3 mRNA CTD PMID:21934132 Kifap3 Mouse all-trans-retinoic acid decreases expression ISO RGD:1313072 6480464 Tretinoin results in decreased expression of KIFAP3 mRNA CTD PMID:33167477 Kifap3 Mouse arsane affects methylation ISO RGD:1313072 6480464 Arsenic affects the methylation of KIFAP3 gene CTD PMID:25304211 Kifap3 Mouse arsenic atom affects methylation ISO RGD:1313072 6480464 Arsenic affects the methylation of KIFAP3 gene CTD PMID:25304211 Kifap3 Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of KIFAP3 protein CTD PMID:37955338 Kifap3 Mouse auramine O increases expression ISO RGD:1313072 6480464 Benzophenoneidum results in increased expression of KIFAP3 protein CTD PMID:28722353 Kifap3 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of KIFAP3 mRNA CTD PMID:19770486 Kifap3 Mouse beta-lapachone increases expression ISO RGD:1313072 6480464 beta-lapachone results in increased expression of KIFAP3 mRNA CTD PMID:38218311 Kifap3 Mouse bis(2-chloroethyl) sulfide decreases expression EXP 6480464 Mustard Gas results in decreased expression of KIFAP3 mRNA CTD PMID:16377760 Kifap3 Mouse bis(2-chloroethyl) sulfide multiple interactions EXP 6480464 Dimercaprol inhibits the reaction [Mustard Gas results in decreased expression of KIFAP3 mRNA] CTD PMID:16377760 Kifap3 Mouse bisphenol A increases expression ISO RGD:1305191 6480464 bisphenol A results in increased expression of KIFAP3 mRNA CTD PMID:25181051 Kifap3 Mouse bisphenol A decreases methylation ISO RGD:1313072 6480464 bisphenol A results in decreased methylation of KIFAP3 gene CTD PMID:31601247 Kifap3 Mouse bisphenol A decreases expression ISO RGD:1305191 6480464 bisphenol A results in decreased expression of KIFAP3 mRNA CTD PMID:30816183 Kifap3 Mouse Brodifacoum increases expression ISO RGD:1305191 6480464 bromfenacoum results in increased expression of KIFAP3 protein CTD PMID:28903499 Kifap3 Mouse calcitriol increases expression ISO RGD:1313072 6480464 Calcitriol results in increased expression of KIFAP3 mRNA CTD PMID:16002434 Kifap3 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of KIFAP3 mRNA CTD PMID:37019170 Kifap3 Mouse chromium(6+) decreases expression ISO RGD:1313072 6480464 chromium hexavalent ion results in decreased expression of KIFAP3 mRNA CTD PMID:30690063 Kifap3 Mouse cisplatin affects expression ISO RGD:1313072 6480464 Cisplatin affects the expression of KIFAP3 mRNA CTD PMID:23300844 Kifap3 Mouse cisplatin multiple interactions ISO RGD:1313072 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KIFAP3 mRNA CTD PMID:27392435 Kifap3 Mouse cisplatin decreases expression ISO RGD:1313072 6480464 Cisplatin results in decreased expression of KIFAP3 mRNA CTD PMID:27392435 Kifap3 Mouse cobalt dichloride decreases expression ISO RGD:1305191 6480464 cobaltous chloride results in decreased expression of KIFAP3 mRNA CTD PMID:24386269 Kifap3 Mouse cyclosporin A decreases expression ISO RGD:1305191 6480464 Cyclosporine results in decreased expression of KIFAP3 mRNA CTD PMID:21865292 Kifap3 Mouse cyclosporin A increases expression ISO RGD:1313072 6480464 Cyclosporine results in increased expression of KIFAP3 mRNA CTD PMID:25562108 Kifap3 Mouse Dibutyl phosphate affects expression ISO RGD:1313072 6480464 di-n-butylphosphoric acid affects the expression of KIFAP3 mRNA CTD PMID:37042841 Kifap3 Mouse dimercaprol multiple interactions EXP 6480464 Dimercaprol inhibits the reaction [Mustard Gas results in decreased expression of KIFAP3 mRNA] CTD PMID:16377760 Kifap3 Mouse dorsomorphin multiple interactions ISO RGD:1313072 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Kifap3 Mouse doxorubicin increases expression ISO RGD:1313072 6480464 Doxorubicin results in increased expression of KIFAP3 mRNA CTD PMID:29803840 Kifap3 Mouse folic acid multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KIFAP3 mRNA CTD PMID:22206623 Kifap3 Mouse FR900359 decreases phosphorylation ISO RGD:1313072 6480464 FR900359 results in decreased phosphorylation of KIFAP3 protein CTD PMID:37730182 Kifap3 Mouse gentamycin decreases expression ISO RGD:1305191 6480464 Gentamicins results in decreased expression of KIFAP3 mRNA CTD PMID:22061828 Kifap3 Mouse indometacin decreases expression ISO RGD:1305191 6480464 Indomethacin results in decreased expression of KIFAP3 mRNA CTD PMID:25972201 Kifap3 Mouse methotrexate affects expression EXP 6480464 Methotrexate affects the expression of KIFAP3 mRNA CTD PMID:18502557 Kifap3 Mouse methylmercury chloride decreases expression ISO RGD:1313072 6480464 methylmercuric chloride results in decreased expression of KIFAP3 mRNA CTD PMID:28001369 Kifap3 Mouse nickel sulfate decreases expression ISO RGD:1313072 6480464 nickel sulfate results in decreased expression of KIFAP3 mRNA CTD PMID:22714537 Kifap3 Mouse panobinostat increases expression ISO RGD:1313072 6480464 panobinostat results in increased expression of KIFAP3 mRNA CTD PMID:26272509 Kifap3 Mouse panobinostat multiple interactions ISO RGD:1313072 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Kifap3 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of KIFAP3 mRNA CTD PMID:17562736 Kifap3 Mouse paracetamol decreases expression ISO RGD:1305191 6480464 Acetaminophen results in decreased expression of KIFAP3 mRNA CTD PMID:33387578 Kifap3 Mouse paracetamol decreases expression ISO RGD:1313072 6480464 Acetaminophen results in decreased expression of KIFAP3 mRNA CTD PMID:21420995 Kifap3 Mouse PCB138 decreases expression ISO RGD:1305191 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of KIFAP3 mRNA CTD PMID:23829299 Kifap3 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of KIFAP3 mRNA CTD PMID:23091169 Kifap3 Mouse potassium chromate multiple interactions ISO RGD:1313072 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of KIFAP3 mRNA CTD PMID:22079256 Kifap3 Mouse potassium chromate decreases expression ISO RGD:1313072 6480464 potassium chromate(VI) results in decreased expression of KIFAP3 mRNA CTD PMID:22079256|PMID:22714537 Kifap3 Mouse pyrogallol increases expression EXP 6480464 Pyrogallol results in increased expression of KIFAP3 mRNA CTD PMID:20362636 Kifap3 Mouse quercetin decreases expression ISO RGD:1313072 6480464 Quercetin results in decreased expression of KIFAP3 mRNA CTD PMID:21632981 Kifap3 Mouse quercetin increases phosphorylation ISO RGD:1313072 6480464 Quercetin results in increased phosphorylation of KIFAP3 protein CTD PMID:35688186 Kifap3 Mouse SB 431542 multiple interactions ISO RGD:1313072 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Kifap3 Mouse sirolimus increases expression ISO RGD:1305191 6480464 Sirolimus results in increased expression of KIFAP3 mRNA CTD PMID:21865292 Kifap3 Mouse Soman decreases expression ISO RGD:1305191 6480464 Soman results in decreased expression of KIFAP3 mRNA CTD PMID:19281266 Kifap3 Mouse sunitinib increases expression ISO RGD:1313072 6480464 Sunitinib results in increased expression of KIFAP3 mRNA CTD PMID:31533062 Kifap3 Mouse tacrolimus hydrate decreases expression ISO RGD:1305191 6480464 Tacrolimus results in decreased expression of KIFAP3 mRNA CTD PMID:21865292 Kifap3 Mouse thiram increases expression ISO RGD:1313072 6480464 Thiram results in increased expression of KIFAP3 mRNA CTD PMID:38568856 Kifap3 Mouse trichostatin A increases expression ISO RGD:1313072 6480464 trichostatin A results in increased expression of KIFAP3 mRNA CTD PMID:24935251|PMID:26272509 Kifap3 Mouse trichostatin A multiple interactions ISO RGD:1313072 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kifap3 Mouse triphenyl phosphate affects expression ISO RGD:1313072 6480464 triphenyl phosphate affects the expression of KIFAP3 mRNA CTD PMID:37042841 Kifap3 Mouse urethane increases expression ISO RGD:1313072 6480464 Urethane results in increased expression of KIFAP3 mRNA CTD PMID:28818685 Kifap3 Mouse valproic acid increases expression ISO RGD:1313072 6480464 Valproic Acid results in increased expression of KIFAP3 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:27188386 Kifap3 Mouse valproic acid multiple interactions ISO RGD:1313072 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Kifap3 Mouse vinclozolin decreases methylation ISO RGD:1305191 6480464 vinclozolin results in decreased methylation of KIFAP3 gene CTD PMID:31079544
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 4-amino-2,6-dinitrotoluene (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (EXP) auramine O (ISO) benzo[a]pyrene (EXP) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (EXP) bisphenol A (ISO) Brodifacoum (ISO) calcitriol (ISO) chlorpyrifos (EXP) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dimercaprol (EXP) dorsomorphin (ISO) doxorubicin (ISO) folic acid (EXP) FR900359 (ISO) gentamycin (ISO) indometacin (ISO) methotrexate (EXP) methylmercury chloride (ISO) nickel sulfate (ISO) panobinostat (ISO) paracetamol (EXP,ISO) PCB138 (ISO) phenobarbital (EXP) potassium chromate (ISO) pyrogallol (EXP) quercetin (ISO) SB 431542 (ISO) sirolimus (ISO) Soman (ISO) sunitinib (ISO) tacrolimus hydrate (ISO) thiram (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (ISO)
Kifap3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 163,589,711 - 163,744,676 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 163,607,152 - 163,744,678 (+) Ensembl GRCm39 Ensembl GRCm38 1 163,762,138 - 163,917,107 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 163,779,583 - 163,917,109 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 165,709,810 - 165,847,231 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 165,616,354 - 165,753,775 (+) NCBI MGSCv36 mm8 Celera 1 166,219,175 - 166,357,571 (+) NCBI Celera Cytogenetic Map 1 H2.1 NCBI cM Map 1 71.08 NCBI
KIFAP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 169,921,329 - 170,085,184 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 169,921,326 - 170,085,208 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 169,890,470 - 170,043,836 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 168,157,094 - 168,310,503 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 166,622,127 - 166,775,537 NCBI Celera 1 143,000,253 - 143,153,688 (-) NCBI Celera Cytogenetic Map 1 q24.2 NCBI HuRef 1 141,112,974 - 141,266,563 (-) NCBI HuRef CHM1_1 1 171,312,642 - 171,466,210 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 169,277,046 - 169,441,099 (-) NCBI T2T-CHM13v2.0
Kifap3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 78,660,849 - 78,797,821 (+) NCBI GRCr8 mRatBN7.2 13 76,127,702 - 76,264,654 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 76,127,696 - 76,264,650 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 78,756,196 - 78,882,717 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 80,065,273 - 80,187,049 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 77,319,837 - 77,441,633 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 82,072,497 - 82,217,256 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 82,072,497 - 82,217,252 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 86,953,053 - 87,089,644 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 79,544,010 - 79,673,768 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 79,558,313 - 79,686,817 (+) NCBI Celera 13 75,872,613 - 75,998,359 (+) NCBI Celera Cytogenetic Map 13 q22 NCBI
KIFAP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 79,677,007 - 79,841,101 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 79,349,883 - 79,513,734 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 145,410,755 - 145,564,248 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 149,127,544 - 149,280,831 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 149,127,548 - 149,280,831 (-) Ensembl panpan1.1 panPan2
KIFAP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 28,581,855 - 28,739,327 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 28,593,425 - 28,739,272 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 28,113,580 - 28,271,198 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 28,383,601 - 28,541,435 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 28,395,164 - 28,542,155 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 28,232,563 - 28,390,147 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 28,267,598 - 28,425,374 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 28,504,316 - 28,661,873 (+) NCBI UU_Cfam_GSD_1.0
Kifap3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 98,789,040 - 98,930,697 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 16,663,974 - 16,779,428 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 16,664,025 - 16,777,440 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KIFAP3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 80,921,682 - 81,108,360 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 80,922,032 - 81,105,135 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 88,552,950 - 88,734,332 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KIFAP3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 58,983,180 - 59,130,431 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 58,983,207 - 59,130,074 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 60,638,540 - 60,786,174 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kifap3
.
Predicted Target Of
Count of predictions: 754 Count of miRNA genes: 293 Interacting mature miRNAs: 327 Transcripts: ENSMUST00000027877, ENSMUST00000077642 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301523 Ccrs1_m corpus callosum hemisphere surface size 1 (mouse) Not determined 1 139602037 173602216 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 12790984 Pcho7_m plasma cholesterol 7 (mouse) 1 147219390 181219390 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 27226767 Tibl10_m tibia length 10, 10 week (mouse) 1 121727729 164827569 Mouse 1300740 Tne1_m total number errors (mouse) Not determined 1 139602037 173602216 Mouse 12790996 Aath2_m aortic arch atherosclerosis 2 (mouse) 1 145077630 179077630 Mouse 12791001 Aath6_m aortic arch atherosclerosis 6 (mouse) 1 147219390 181219390 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 1301818 Ap1q_m alcohol preference 1 QTL (mouse) Not determined 1 146908199 167586222 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 27226799 Feml5_m femur length 5, 5 week (mouse) 1 122027729 164827569 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357602 Vtbt2_m vertebral trabecular bone trait 2 (mouse) Not determined 1 139602037 173602216 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1300777 Chol10_m cholesterol 10 (mouse) Not determined 9 147875502 181875616 Mouse 1302098 Eila1_m ethanol induced locomotor activity 1 (mouse) Not determined 1 112008822 175468938 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1300571 Opfa_m open field activity (mouse) Not determined 1 144531347 178531592 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 4141160 Cq1_m cholesterol QTL 1 (mouse) Not determined 1 139452188 173452308 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 10043899 Hdlq99_m HDL QTL 99 (mouse) Not determined 1 147875502 181875616 Mouse 1302128 Ity3_m immunity to S. typhimurium 3 (mouse) Not determined 11 131156308 165139464 Mouse 11537365 Cnes4_m C. neoformans susceptibility locus 4 (mouse) 1 144449142 178449142 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1357434 Obsty1_m obesity 1 (mouse) Not determined 1 136209950 170210094 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 4142149 Ctex_m Ctla4 expression QTL (mouse) Not determined 1 153557406 175468938 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse 12910521 Scgq1_m spontaneous crescentic glomerulonephritis QTL 1 (mouse) 1 156602037 176262693 Mouse 12910522 Scgq2_m spontaneous crescentic glomerulonephritis QTL 2 (mouse) 1 147125258 171632257 Mouse 11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4142014 Wbcq5_m white blood cell quantitative locus 5 (mouse) Not determined 1 141095010 175095156 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 14746980 Manh50_m mandible shape 50 (mouse) 1 134131564 168131564 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301151 Hdlq14_m HDL QTL 14 (mouse) Not determined 1 142489543 176489734 Mouse 1301149 Lrnx12_m learning-contextual 12 (mouse) Not determined 1 112008822 168186402 Mouse 4141233 Femwf12_m femur work to failure 12 (mouse) Not determined 141233173 175233272 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 1301894 Skull2_m skull morphology 2 (mouse) Not determined 1 139602037 173602216 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 13452397 Leusq4_m leucocytosis susceptibility QTL 4 (mouse) 1 156602037 170803640 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 1302193 Cpfd1_m cerebellum pattern fissures (mouse) Not determined 1 139602037 173602216 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 13452393 Ity3b_m immunity to S. typhimurium 3b (mouse) 1 156497439 172097436 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 13452394 Leusq1_m leucocytosis susceptibility QTL 1 (mouse) 1 156602037 168186402 Mouse 1301408 Lore8_m loss of righting induced by ethanol 8 (mouse) Not determined 1 135877901 169878015 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 27095901 Scvln8_m sacral vertebrae length 2, 10 week (mouse) 1 94127725 172027567 Mouse 11049576 Lmr8a_m leishmaniasis resistance 8a (mouse) 1 139602037 173602216 Mouse 1301458 Skts8_m skin tumor susceptibility 8 (mouse) Not determined 1 135794822 169795012 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301467 Pcir1_m periosteal circumference 1 (mouse) Not determined 1 141233173 175233272 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 1300696 Bpq2_m blood pressure QTL 2 (mouse) Not determined 1 139602037 173602216 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 1301191 Stia1_m serum transfer induced arthritis 1 (mouse) Not determined 1 141233173 175233272 Mouse 1300934 Cfbw1_m cystic fibrosis body weight 1 (mouse) Not determined 1 145145207 179145325 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 1558720 Bpq8_m blood pressure QTL 8 (mouse) Not determined 1 143284665 177284803 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 1301710 Bmd5_m bone mineral density 5 (mouse) Not determined 1 139602037 173602216 Mouse 27095935 Ulnl5_m ulna length 5, 10 week (mouse) 1 128727737 181327565 Mouse 1301232 Hcs7_m hepatocarcinogenesis susceptibility 7 (mouse) Not determined 1 156602037 168186402 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1357567 Nidd3k_m Nidd3 on KK-A<y> (mouse) Not determined 7 147125258 169038913 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 27095915 Scvln13_m sacral vertebrae length 2, 16 week (mouse) 1 117527730 179827565 Mouse 11533913 Rd6m1_m retinal degeneration 6 modifier 1 (mouse) 1 141233173 175233272 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000027877 ⟹ ENSMUSP00000027877
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 163,607,152 - 163,744,678 (+) Ensembl GRCm38.p6 Ensembl 1 163,779,583 - 163,917,109 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000077642 ⟹ ENSMUSP00000076830
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 163,607,152 - 163,744,678 (+) Ensembl GRCm38.p6 Ensembl 1 163,779,583 - 163,917,109 (+) Ensembl
RefSeq Acc Id:
NM_001305643 ⟹ NP_001292572
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 163,607,152 - 163,744,676 (+) NCBI GRCm38 1 163,779,583 - 163,917,107 (+) NCBI
Sequence:
GTGAGCGCATGCGCCTTGCGGAGAGTTCGGCCCTGACGGCTCTGGGCGGGTCTGGGCTGCTCCAGTGTTTTGGGGCCCAGGAGCAGTGGGAGGAGCCGGCGGGTTCACCGTGGTAACCGCTGCGCCGC
hide sequence
RefSeq Acc Id:
NM_010629 ⟹ NP_034759
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 163,607,152 - 163,744,676 (+) NCBI GRCm38 1 163,779,583 - 163,917,107 (+) NCBI MGSCv37 1 165,709,810 - 165,847,231 (+) RGD Celera 1 166,219,175 - 166,357,571 (+) RGD cM Map 1 ENTREZGENE
Sequence:
GTGAGCGCATGCGCCTTGCGGAGAGTTCGGCCCTGACGGCTCTGGGCGGGTCTGGGCTGCTCCAGTGTTTTGGGGCCCAGGAGCAGTGGGAGGAGCCGGCGGGTTCACCGTGGTAACCGCTGCGCCGC
hide sequence
RefSeq Acc Id:
XM_006496679 ⟹ XP_006496742
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 163,589,712 - 163,744,673 (+) NCBI GRCm38 1 163,762,139 - 163,917,104 (+) NCBI
Sequence:
GGGGTTGCCACCATCAAGAATAAGATGCATTGTAAGGACTCCTTTTAACTGAAATCTCCTTTGT
hide sequence
RefSeq Acc Id:
XM_006496681 ⟹ XP_006496744
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 163,589,711 - 163,744,673 (+) NCBI GRCm38 1 163,762,138 - 163,917,104 (+) NCBI
Sequence:
GGGGGTTGCCACCATCAAGAATAAGATGCATTGTAAGGACTCCTTTTAACTGAAATCTCCTTTG
hide sequence
RefSeq Acc Id:
NP_034759 ⟸ NM_010629
- Peptide Label:
isoform KAP3B
- UniProtKB:
Q3UZA5 (UniProtKB/TrEMBL)
- Sequence:
MQGEDARYLKRKVKGGNIDVHPSEKALIVQYEVEATILGEMGDPMLGERKECQKIIRLKSLNANTDITSLARKVVEECKLIHPSKLSEVEQLLYYLQNRRDSLPGKEKKEKSSKPKDPPPFEGMEIDE
hide sequence
RefSeq Acc Id:
XP_006496744 ⟸ XM_006496681
- Peptide Label:
isoform X2
- UniProtKB:
Q3UZA5 (UniProtKB/TrEMBL)
- Sequence:
MTALITGGCGFFGPQWPFDDVPKAVTRKVKGGNIDVHPSEKALIVQYEVEATILGEMGDPMLGE
hide sequence
RefSeq Acc Id:
XP_006496742 ⟸ XM_006496679
- Peptide Label:
isoform X1
- UniProtKB:
Q3UZA5 (UniProtKB/TrEMBL)
- Sequence:
MTALITGGCGFFGPQWPFDDVPKAVTRKVKGGNIDVHPSEKALIVQYEVEATILGEMGDPMLGERKECQKIIRLKSLNANTDITSLARKVVEECKLIHPSKLSEVEQLLYYLQNRRDSLPGKEKKEKS
hide sequence
RefSeq Acc Id:
NP_001292572 ⟸ NM_001305643
- Peptide Label:
isoform KAP3A
- UniProtKB:
P70189 (UniProtKB/Swiss-Prot), Q6GTS3 (UniProtKB/Swiss-Prot), P70188 (UniProtKB/Swiss-Prot), Q3UZA5 (UniProtKB/TrEMBL)
- Sequence:
MQGEDARYLKRKVKGGNIDVHPSEKALIVQYEVEATILGEMGDPMLGERKECQKIIRLKSLNAN
hide sequence
Ensembl Acc Id:
ENSMUSP00000027877 ⟸ ENSMUST00000027877
Ensembl Acc Id:
ENSMUSP00000076830 ⟸ ENSMUST00000077642
RGD ID: 6875494 Promoter ID: EPDNEW_M1197 Type: initiation region Name: Kifap3_1 Description: Mus musculus kinesin-associated protein 3 , transcript variant1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 163,779,646 - 163,779,706 EPDNEW
RGD ID: 6817982 Promoter ID: MM_KWN:2668 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Lung Transcripts: OTTMUST00000044067, OTTMUST00000044068 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 165,709,541 - 165,710,041 (+) MPROMDB
