Symbol:
Thoc5
Name:
THO complex 5
RGD ID:
1312750
MGI Page
MGI
Description:
Enables mRNA binding activity. Involved in primitive hemopoiesis. Acts upstream of or within several processes, including negative regulation of macrophage differentiation; regulation of mRNA export from nucleus; and regulation of stem cell division. Located in nucleus. Is expressed in brain; early conceptus; and inner cell mass. Human ortholog(s) of this gene implicated in breast carcinoma. Orthologous to human THOC5 (THO complex subunit 5).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1700060C24Rik; A430085L24Rik; Fm; Fmip; Fms interacting protein; fms-interacting protein; MGC49541; PK1.; PK1.3; RP23-64E17.4; serum/glucocorticoid regulated kinase 2; Sgk2; THO complex subunit 5 homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
THOC5 (THO complex subunit 5) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
Thoc5 (THO complex subunit 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Thoc5 (THO complex subunit 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
THOC5 (THO complex subunit 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
THOC5 (THO complex subunit 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Thoc5 (THO complex subunit 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
THOC5 (THO complex subunit 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Thoc5 (THO complex subunit 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Thoc5 (THO complex subunit 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
THOC5 (THO complex subunit 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
thoc5 (THO complex 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
thoc-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
thoc5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
thoc5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 4,845,339 - 4,878,867 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 4,845,320 - 4,878,867 (+) Ensembl GRCm39 Ensembl GRCm38 11 4,895,283 - 4,928,867 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 4,895,320 - 4,928,867 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 4,795,346 - 4,828,868 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 4,795,346 - 4,828,868 (+) NCBI MGSCv36 mm8 Celera 11 5,392,170 - 5,426,353 (+) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 3.09 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Thoc5 Mouse Breast Cancer, Familial ISO RGD:1349222 8554872 ClinVar Annotator: match by term: Familial cancer of breast ClinVar PMID:16551709|PMID:17085682|PMID:21876083|PMID:24713400|PMID:24763289|PMID:28492532 Thoc5 Mouse vestibular schwannomatosis ISO RGD:1349222 8554872 ClinVar Annotator: match by term: Neurofibromatosis, type 2 ClinVar PMID:10220142|PMID:15645494|PMID:16983642|PMID:19968670|PMID:28492532|PMID:9643284|PMID:9817927
Only show annotations with direct experimental evidence (0 objects hidden)
Thoc5 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of THOC5 mRNA CTD PMID:22206623 Thoc5 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of THOC5 mRNA CTD PMID:17942748 Thoc5 Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of THOC5 mRNA CTD PMID:31388691 Thoc5 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of THOC5 mRNA CTD PMID:17942748 Thoc5 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1304991 6480464 Tetrachlorodibenzodioxin results in increased expression of THOC5 mRNA CTD PMID:33387578 Thoc5 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of THOC5 mRNA CTD PMID:21570461 Thoc5 Mouse 2,4-dinitrotoluene affects expression ISO RGD:1304991 6480464 2,4-dinitrotoluene affects the expression of THOC5 mRNA CTD PMID:21346803 Thoc5 Mouse 2,6-dinitrotoluene affects expression ISO RGD:1304991 6480464 2,6-dinitrotoluene affects the expression of THOC5 mRNA CTD PMID:21346803 Thoc5 Mouse 2-methylcholine affects expression ISO RGD:1349222 6480464 beta-methylcholine affects the expression of THOC5 mRNA CTD PMID:21179406 Thoc5 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1349222 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Thoc5 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of THOC5 mRNA CTD PMID:39298647 Thoc5 Mouse acrylamide increases expression ISO RGD:1304991 6480464 Acrylamide results in increased expression of THOC5 mRNA CTD PMID:28959563 Thoc5 Mouse acrylamide increases expression ISO RGD:1349222 6480464 Acrylamide results in increased expression of THOC5 mRNA CTD PMID:32763439 Thoc5 Mouse all-trans-retinoic acid decreases expression ISO RGD:1349222 6480464 Tretinoin results in decreased expression of THOC5 mRNA CTD PMID:33167477 Thoc5 Mouse atrazine decreases expression ISO RGD:1349222 6480464 Atrazine results in decreased expression of THOC5 mRNA CTD PMID:22378314 Thoc5 Mouse benzo[a]pyrene affects methylation ISO RGD:1349222 6480464 Benzo(a)pyrene affects the methylation of THOC5 promoter CTD PMID:27901495 Thoc5 Mouse beta-lapachone increases expression ISO RGD:1349222 6480464 beta-lapachone results in increased expression of THOC5 mRNA CTD PMID:38218311 Thoc5 Mouse bisphenol A increases expression ISO RGD:1304991 6480464 bisphenol A results in increased expression of THOC5 mRNA CTD PMID:25181051|PMID:34947998 Thoc5 Mouse bisphenol AF increases expression ISO RGD:1349222 6480464 bisphenol AF results in increased expression of THOC5 protein CTD PMID:34186270 Thoc5 Mouse Bisphenol B increases expression ISO RGD:1349222 6480464 bisphenol B results in increased expression of THOC5 protein CTD PMID:34186270 Thoc5 Mouse bisphenol F multiple interactions ISO RGD:1349222 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Thoc5 Mouse bisphenol F increases expression ISO RGD:1349222 6480464 bisphenol F results in increased expression of THOC5 protein CTD PMID:34186270 Thoc5 Mouse caffeine increases phosphorylation ISO RGD:1349222 6480464 Caffeine results in increased phosphorylation of THOC5 protein CTD PMID:35688186 Thoc5 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of THOC5 mRNA CTD PMID:37019170 Thoc5 Mouse coumestrol increases expression ISO RGD:1349222 6480464 Coumestrol results in increased expression of THOC5 mRNA CTD PMID:19167446 Thoc5 Mouse dexamethasone multiple interactions ISO RGD:1349222 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Thoc5 Mouse flutamide increases expression ISO RGD:1304991 6480464 Flutamide results in increased expression of THOC5 mRNA CTD PMID:24136188 Thoc5 Mouse FR900359 affects phosphorylation ISO RGD:1349222 6480464 FR900359 affects the phosphorylation of THOC5 protein CTD PMID:37730182 Thoc5 Mouse indometacin multiple interactions ISO RGD:1349222 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Thoc5 Mouse ivermectin decreases expression ISO RGD:1349222 6480464 Ivermectin results in decreased expression of THOC5 protein CTD PMID:32959892 Thoc5 Mouse lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of THOC5 mRNA CTD PMID:20542052 Thoc5 Mouse lead(0) affects expression ISO RGD:1349222 6480464 Lead affects the expression of THOC5 mRNA CTD PMID:28903495 Thoc5 Mouse paracetamol decreases expression ISO RGD:1304991 6480464 Acetaminophen results in decreased expression of THOC5 mRNA CTD PMID:33387578 Thoc5 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of THOC5 mRNA CTD PMID:23811191 Thoc5 Mouse quercetin increases phosphorylation ISO RGD:1349222 6480464 Quercetin results in increased phosphorylation of THOC5 protein CTD PMID:35688186 Thoc5 Mouse silicon dioxide decreases expression ISO RGD:1349222 6480464 Silicon Dioxide results in decreased expression of THOC5 mRNA CTD PMID:25351596 Thoc5 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of THOC5 gene CTD PMID:35295148 Thoc5 Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of THOC5 mRNA CTD PMID:19042947 Thoc5 Mouse triphenyl phosphate affects expression ISO RGD:1349222 6480464 triphenyl phosphate affects the expression of THOC5 mRNA CTD PMID:37042841 Thoc5 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of THOC5 mRNA CTD PMID:17292431 Thoc5 Mouse valproic acid affects expression ISO RGD:1349222 6480464 Valproic Acid affects the expression of THOC5 mRNA CTD PMID:25979313
1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) caffeine (ISO) chlorpyrifos (EXP) coumestrol (ISO) dexamethasone (ISO) flutamide (ISO) FR900359 (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (EXP) lead(0) (ISO) paracetamol (ISO) pirinixic acid (EXP) quercetin (ISO) silicon dioxide (ISO) titanium dioxide (EXP) trimellitic anhydride (EXP) triphenyl phosphate (ISO) valproic acid (EXP,ISO)
Thoc5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 4,845,339 - 4,878,867 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 4,845,320 - 4,878,867 (+) Ensembl GRCm39 Ensembl GRCm38 11 4,895,283 - 4,928,867 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 4,895,320 - 4,928,867 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 4,795,346 - 4,828,868 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 4,795,346 - 4,828,868 (+) NCBI MGSCv36 mm8 Celera 11 5,392,170 - 5,426,353 (+) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 3.09 NCBI
THOC5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 29,505,879 - 29,553,757 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 29,505,879 - 29,555,216 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 29,901,868 - 29,949,746 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 28,234,156 - 28,279,736 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 22 13,703,995 - 13,749,471 (-) NCBI Celera Cytogenetic Map 22 q12.2 NCBI HuRef 22 12,867,987 - 12,913,507 (-) NCBI HuRef CHM1_1 22 29,863,485 - 29,909,025 (-) NCBI CHM1_1 T2T-CHM13v2.0 22 29,969,253 - 30,017,117 (-) NCBI T2T-CHM13v2.0
Thoc5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 83,982,302 - 84,016,193 (+) NCBI GRCr8 mRatBN7.2 14 79,758,805 - 79,792,718 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 79,758,917 - 79,792,718 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 84,189,540 - 84,223,312 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 85,429,616 - 85,463,386 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 81,879,283 - 81,913,206 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 85,138,219 - 85,171,729 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 85,142,279 - 85,171,726 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 85,816,054 - 85,849,564 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 85,561,381 - 85,612,915 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 85,580,525 - 85,607,648 (+) NCBI Celera 14 78,667,519 - 78,697,308 (+) NCBI Celera Cytogenetic Map 14 q21 NCBI
Thoc5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 3,761,874 - 3,795,517 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 3,761,933 - 3,795,517 (-) NCBI ChiLan1.0 ChiLan1.0
THOC5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 39,481,933 - 39,528,384 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 42,183,149 - 42,229,624 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 10,553,665 - 10,599,948 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 28,357,644 - 28,405,148 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 28,357,644 - 28,404,346 (-) Ensembl panpan1.1 panPan2
THOC5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 22,748,857 - 22,785,288 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 22,748,895 - 22,784,143 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 22,620,394 - 22,656,869 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 23,122,931 - 23,158,983 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 23,104,476 - 23,173,587 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 22,832,277 - 22,868,802 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 23,095,597 - 23,131,788 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 23,154,953 - 23,191,708 (-) NCBI UU_Cfam_GSD_1.0
Thoc5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 112,366,675 - 112,406,795 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936657 3,461,789 - 3,503,976 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936657 3,465,707 - 3,503,966 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
THOC5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 12,386,742 - 12,427,980 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 12,385,431 - 12,427,090 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 113,711,741 - 113,752,521 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Thoc5
.
Predicted Target Of
Count of predictions: 899 Count of miRNA genes: 499 Interacting mature miRNAs: 587 Transcripts: ENSMUST00000038237, ENSMUST00000101615, ENSMUST00000142543, ENSMUST00000144371, ENSMUST00000148117, ENSMUST00000155872 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300599 Cocrb11_m cocaine related behavior 11 (mouse) Not determined 11 2670355 36671472 Mouse 26884446 Sklq10_m skull length QTL 10, 10 week (mouse) 11 3250000 62890826 Mouse 1300661 Lmr6_m leishmaniasis resistance 6 (mouse) Not determined 11 1 25976374 Mouse 13208559 Wght10_m weight 10 (mouse) 11 3950000 88890826 Mouse 13208558 Lgth12_m body length 12 (mouse) 11 3950000 94890826 Mouse 27095925 Pglq5_m pelvic girdle length QTL 5, 5 week (mouse) 11 3250000 19750000 Mouse 27226741 Metcl5_m metatarsal-calcaneal length 5, 5 week (mouse) 11 4650000 46290827 Mouse 1357722 Vtbt11_m vertebral trabecular bone trait 11 (mouse) Not determined 11 1 23880487 Mouse 10044008 Hbnr15_m Heligmosomoides bakeri nematode resistance 15 (mouse) Not determined 11 227052 34227232 Mouse 27226798 Scvln18_m sacral vertebrae length 2, 16 week (mouse) 11 3250000 60690826 Mouse 27095919 Pglq10_m pelvic girdle length QTL 10, 10 week (mouse) 11 3250000 18450000 Mouse 1300768 Tshp9_m tooth shape 9 (mouse) Not determined 11 1 25976374 Mouse 10053676 Eae44a_m experimental allergic encephalomyelitis susceptibility 44a (mouse) Not determined 11 4507896 21379532 Mouse 1301765 Skull15_m skull morphology 15 (mouse) Not determined 11 1 25976374 Mouse 27095914 Pglq16_m pelvic girdle length QTL 16, 16 week (mouse) 11 3250000 18150000 Mouse 27095909 Scvln6_m sacral vertebrae length 2, 5 week (mouse) 11 3250000 44090827 Mouse 27095904 Scvln12_m sacral vertebrae length 2, 10 week (mouse) 11 3250000 34495048 Mouse 26884453 Sklq16_m skull length QTL 16, 16 week (mouse) 11 3250000 72690826 Mouse
AJ001260
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 11 4,893,445 - 4,893,526 UniSTS GRCm38 MGSCv37 11 4,793,448 - 4,793,529 UniSTS GRCm37 Celera 11 5,390,288 - 5,390,369 UniSTS Cytogenetic Map 11 A1 UniSTS Whitehead/MRC_RH 11 17.49 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000038237 ⟹ ENSMUSP00000045580
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,845,343 - 4,878,865 (+) Ensembl GRCm38.p6 Ensembl 11 4,895,343 - 4,928,865 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000101615 ⟹ ENSMUSP00000099137
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,845,320 - 4,878,867 (+) Ensembl GRCm38.p6 Ensembl 11 4,895,320 - 4,928,867 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142543 ⟹ ENSMUSP00000118940
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,852,212 - 4,868,225 (+) Ensembl GRCm38.p6 Ensembl 11 4,902,212 - 4,918,225 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000144371
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,852,212 - 4,864,310 (+) Ensembl GRCm38.p6 Ensembl 11 4,902,212 - 4,914,310 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000148117
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,852,212 - 4,854,465 (+) Ensembl GRCm38.p6 Ensembl 11 4,902,212 - 4,904,465 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155872
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 11 4,865,306 - 4,870,485 (+) Ensembl GRCm38.p6 Ensembl 11 4,915,306 - 4,920,485 (+) Ensembl
RefSeq Acc Id:
NM_001418151 ⟹ NP_001405080
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 4,845,339 - 4,878,867 (+) NCBI
RefSeq Acc Id:
NM_172438 ⟹ NP_766026
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 11 4,845,339 - 4,878,867 (+) NCBI GRCm38 11 4,895,343 - 4,928,865 (+) NCBI MGSCv37 11 4,795,346 - 4,828,868 (+) RGD Celera 11 5,392,170 - 5,426,353 (+) RGD cM Map 11 ENTREZGENE
Sequence:
GTGGCTACCCGGCTGGAAGGCGTGAGGAGCATTCTGCCTTTTCACCTGGAAGCACAATGTCATCAGAATCCAGCAAAAAACGGAAACCCAAAGTGATCCGGAGTGATGGAACCCCAACTGAAGGGAAA
hide sequence
RefSeq Acc Id:
NP_766026 ⟸ NM_172438
- Peptide Label:
isoform 1
- UniProtKB:
Q8CHR3 (UniProtKB/Swiss-Prot), Q8BKT7 (UniProtKB/Swiss-Prot), Q69ZU0 (UniProtKB/Swiss-Prot), A0A0R4J0J6 (UniProtKB/TrEMBL)
- Sequence:
MSSESSKKRKPKVIRSDGTPTEGKRNRSDTEQEGKYYSEEAEVDLRDPGRDYELYKYTCQELQRLMAEIQDLKSKGSKDLAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDAYHL
hide sequence
Ensembl Acc Id:
ENSMUSP00000099137 ⟸ ENSMUST00000101615
Ensembl Acc Id:
ENSMUSP00000118940 ⟸ ENSMUST00000142543
Ensembl Acc Id:
ENSMUSP00000045580 ⟸ ENSMUST00000038237
RefSeq Acc Id:
NP_001405080 ⟸ NM_001418151
- Peptide Label:
isoform 2
- UniProtKB:
Q8CHR3 (UniProtKB/Swiss-Prot), Q8BKT7 (UniProtKB/Swiss-Prot), Q69ZU0 (UniProtKB/Swiss-Prot)
RGD ID: 6822307 Promoter ID: MM_KWN:6257 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000101615, ENSMUST00000109903, NM_172438 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 11 4,795,031 - 4,795,531 (+) MPROMDB
RGD ID: 8673816 Promoter ID: EPDNEW_M14939 Type: multiple initiation site Name: Thoc5_1 Description: Mus musculus THO complex 5 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 11 4,895,339 - 4,895,399 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Thoc5
THO complex 5
Sgk2
serum/glucocorticoid regulated kinase 2
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
Sgk2
serum/glucocorticoid regulated kinase 2
Thoc5
THO complex 5
Symbol and/or name change
5135510 APPROVED
