Symbol:
Usp14
Name:
ubiquitin specific peptidase 14
RGD ID:
1311825
Description:
Predicted to enable deubiquitinase activity; endopeptidase inhibitor activity; and proteasome binding activity. Predicted to be involved in negative regulation of proteolysis involved in protein catabolic process; protein K48-linked deubiquitination; and regulation of chemotaxis. Predicted to act upstream of or within chemical synaptic transmission. Predicted to be located in several cellular components, including cell surface; endoplasmic reticulum; and nucleolus. Predicted to be active in glutamatergic synapse and presynaptic cytosol. Orthologous to human USP14 (ubiquitin specific peptidase 14); INTERACTS WITH (+)-schisandrin B; 2,4,6-trinitrotoluene; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC291796; MGC95160; ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase); ubiquitin specific protease 14
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
USP14 (ubiquitin specific peptidase 14) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Usp14 (ubiquitin specific peptidase 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Usp14 (ubiquitin specific peptidase 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
USP14 (ubiquitin specific peptidase 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
USP14 (ubiquitin specific peptidase 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp14 (ubiquitin specific peptidase 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
USP14 (ubiquitin specific peptidase 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
USP14 (ubiquitin specific peptidase 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Usp14 (ubiquitin specific peptidase 14) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ANG (angiogenin) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
USP14 (ubiquitin specific peptidase 14)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Usp14 (ubiquitin specific peptidase 14)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp14 (ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
UBP6
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Usp14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
usp-14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
usp14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 1,292,745 - 1,330,867 (-) NCBI GRCr8 mRatBN7.2 18 1,018,111 - 1,057,727 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 1,019,400 - 1,057,519 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 1,247,719 - 1,285,312 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 2,035,549 - 2,073,143 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 1,249,617 - 1,287,210 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 1,178,785 - 1,216,573 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 1,178,787 - 1,216,409 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 1,220,909 - 1,259,524 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 1,292,799 - 1,330,478 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 1,292,800 - 1,330,478 (-) NCBI Celera 18 913,079 - 950,655 (-) NCBI Celera Cytogenetic Map 18 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp14 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of USP14 mRNA] CTD PMID:31150632 Usp14 Rat (1->4)-beta-D-glucan multiple interactions ISO Usp14 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of USP14 mRNA CTD PMID:36331819 Usp14 Rat 1,2-dimethylhydrazine multiple interactions ISO Usp14 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP14 mRNA CTD PMID:22206623 Usp14 Rat 1,2-dimethylhydrazine decreases expression ISO Usp14 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP14 mRNA CTD PMID:22206623 Usp14 Rat 1H-pyrazole increases expression ISO Usp14 (Mus musculus) 6480464 pyrazole results in increased expression of USP14 mRNA CTD PMID:17945193 Usp14 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp14 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP14 mRNA CTD PMID:21570461 Usp14 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of USP14 mRNA CTD PMID:21346803 Usp14 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Usp14 (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Usp14 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of USP14 mRNA CTD PMID:21346803 Usp14 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of USP14 mRNA CTD PMID:21346803 Usp14 Rat 2-methylcholine affects expression ISO USP14 (Homo sapiens) 6480464 beta-methylcholine affects the expression of USP14 mRNA CTD PMID:21179406 Usp14 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO USP14 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of USP14 protein CTD PMID:31675489 Usp14 Rat 3H-1,2-dithiole-3-thione increases expression ISO Usp14 (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in increased expression of USP14 mRNA CTD PMID:15375163 Usp14 Rat 4,4'-sulfonyldiphenol increases expression ISO Usp14 (Mus musculus) 6480464 bisphenol S results in increased expression of USP14 mRNA CTD PMID:39298647 Usp14 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of USP14 mRNA CTD PMID:21346803 Usp14 Rat 5-fluorouracil decreases expression ISO USP14 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of USP14 protein CTD PMID:16803524 Usp14 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of USP14 mRNA CTD PMID:30047161 Usp14 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of USP14 mRNA CTD PMID:28959563 Usp14 Rat all-trans-retinoic acid decreases expression ISO USP14 (Homo sapiens) 6480464 Tretinoin results in decreased expression of USP14 mRNA CTD PMID:33167477 Usp14 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of USP14 mRNA CTD PMID:38685447 Usp14 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of USP14 mRNA CTD PMID:30047161 Usp14 Rat antirheumatic drug increases expression ISO USP14 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of USP14 mRNA CTD PMID:24449571 Usp14 Rat aristolochic acid A decreases expression ISO USP14 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP14 mRNA CTD PMID:33212167 Usp14 Rat Aroclor 1254 decreases expression ISO Usp14 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of USP14 mRNA CTD PMID:23650126 Usp14 Rat arsane multiple interactions ISO USP14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of USP14 mRNA CTD PMID:39836092 Usp14 Rat arsenic atom multiple interactions ISO USP14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of USP14 mRNA CTD PMID:39836092 Usp14 Rat benzatropine increases expression ISO USP14 (Homo sapiens) 6480464 Benztropine results in increased expression of USP14 protein CTD PMID:34122009 Usp14 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of USP14 mRNA CTD PMID:21839799 Usp14 Rat benzo[a]pyrene increases expression ISO Usp14 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of USP14 mRNA CTD PMID:22228805 Usp14 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Usp14 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of USP14 mRNA] CTD PMID:19850644 Usp14 Rat bis(2-ethylhexyl) phthalate increases expression ISO Usp14 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of USP14 mRNA CTD PMID:19850644 and PMID:21318169 Usp14 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP14 mRNA CTD PMID:25181051 Usp14 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP14 mRNA CTD PMID:30816183 Usp14 Rat Bisphenol B increases expression ISO USP14 (Homo sapiens) 6480464 bisphenol B results in increased expression of USP14 protein CTD PMID:34186270 Usp14 Rat butanal decreases expression ISO USP14 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of USP14 mRNA CTD PMID:26079696 Usp14 Rat butane-2,3-dione increases expression ISO USP14 (Homo sapiens) 6480464 Diacetyl results in increased expression of USP14 protein CTD PMID:34031698 Usp14 Rat cadmium dichloride affects localization ISO USP14 (Homo sapiens) 6480464 Cadmium Chloride affects the localization of USP14 protein CTD PMID:18261755 Usp14 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of USP14 promoter CTD PMID:22457795 Usp14 Rat carbon nanotube decreases expression ISO Usp14 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of USP14 mRNA CTD PMID:25620056 Usp14 Rat carbon nanotube increases expression ISO Usp14 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of USP14 mRNA CTD PMID:25554681 Usp14 Rat CGP 52608 multiple interactions ISO USP14 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP14 gene] CTD PMID:28238834 Usp14 Rat chenodeoxycholic acid multiple interactions ISO USP14 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of USP14 mRNA CTD PMID:32152650 Usp14 Rat chromium(6+) affects expression ISO Usp14 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of USP14 mRNA CTD PMID:28472532 Usp14 Rat cisplatin decreases expression ISO USP14 (Homo sapiens) 6480464 Cisplatin results in decreased expression of USP14 protein CTD PMID:16803524 Usp14 Rat clofibrate multiple interactions ISO Usp14 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of USP14 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of USP14 mRNA] CTD PMID:17585979 Usp14 Rat cobalt dichloride increases expression ISO USP14 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of USP14 mRNA CTD PMID:19320972 and PMID:19376846 Usp14 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of USP14 mRNA CTD PMID:24386269 Usp14 Rat copper(II) sulfate increases expression ISO USP14 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of USP14 mRNA CTD PMID:19549813 Usp14 Rat crocidolite asbestos decreases expression ISO Usp14 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of USP14 mRNA CTD PMID:29279043 Usp14 Rat cyclosporin A increases expression ISO USP14 (Homo sapiens) 6480464 Cyclosporine results in increased expression of USP14 mRNA CTD PMID:20106945 Usp14 Rat cyclosporin A multiple interactions ISO USP14 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of USP14 mRNA CTD PMID:32152650 Usp14 Rat deoxycholic acid multiple interactions ISO USP14 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of USP14 mRNA CTD PMID:32152650 Usp14 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of USP14 mRNA CTD PMID:21266533 Usp14 Rat doxorubicin decreases expression ISO USP14 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of USP14 mRNA CTD PMID:29803840 Usp14 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of USP14 protein CTD PMID:19609968 Usp14 Rat ethanol affects splicing ISO Usp14 (Mus musculus) 6480464 Ethanol affects the splicing of USP14 mRNA CTD PMID:30319688 Usp14 Rat ethanol increases expression ISO Usp14 (Mus musculus) 6480464 Ethanol results in increased expression of USP14 mRNA CTD PMID:30319688 Usp14 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of USP14 mRNA CTD PMID:24136188 Usp14 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of USP14 mRNA CTD PMID:24136188 Usp14 Rat folic acid decreases expression ISO Usp14 (Mus musculus) 6480464 Folic Acid results in decreased expression of USP14 mRNA CTD PMID:25629700 Usp14 Rat folic acid multiple interactions ISO Usp14 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP14 mRNA CTD PMID:22206623 Usp14 Rat formaldehyde decreases expression ISO USP14 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of USP14 mRNA CTD PMID:23649840 Usp14 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP14 mRNA CTD PMID:22061828 Usp14 Rat glycochenodeoxycholic acid multiple interactions ISO USP14 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of USP14 mRNA CTD PMID:32152650 Usp14 Rat glycocholic acid multiple interactions ISO USP14 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of USP14 mRNA CTD PMID:32152650 Usp14 Rat glycodeoxycholic acid multiple interactions ISO USP14 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of USP14 mRNA CTD PMID:32152650 Usp14 Rat Heptachlor epoxide increases expression ISO Usp14 (Mus musculus) 6480464 Heptachlor Epoxide results in increased expression of USP14 mRNA CTD PMID:25270620 Usp14 Rat ivermectin decreases expression ISO USP14 (Homo sapiens) 6480464 Ivermectin results in decreased expression of USP14 protein CTD PMID:32959892 Usp14 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of USP14 mRNA CTD PMID:24136188 Usp14 Rat manganese atom multiple interactions ISO USP14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of USP14 mRNA CTD PMID:39836092 Usp14 Rat manganese(0) multiple interactions ISO USP14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of USP14 mRNA CTD PMID:39836092 Usp14 Rat manganese(II) chloride multiple interactions ISO USP14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of USP14 mRNA CTD PMID:39836092 Usp14 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of USP14 mRNA CTD PMID:30047161 Usp14 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Usp14 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of USP14 mRNA CTD PMID:20061341 Usp14 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of USP14 mRNA CTD PMID:24136188 Usp14 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of USP14 mRNA CTD PMID:24136188 Usp14 Rat paracetamol multiple interactions ISO Usp14 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of USP14 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of USP14 mRNA] CTD PMID:17585979 Usp14 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of USP14 mRNA CTD PMID:33387578 Usp14 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of USP14 mRNA CTD PMID:32680482 Usp14 Rat pentachlorophenol increases expression ISO Usp14 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of USP14 mRNA CTD PMID:23892564 Usp14 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp14 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of USP14 mRNA CTD PMID:36331819 Usp14 Rat phenethyl isothiocyanate affects binding ISO USP14 (Homo sapiens) 6480464 USP14 protein binds to phenethyl isothiocyanate CTD PMID:21838287 Usp14 Rat phenobarbital increases expression ISO Usp14 (Mus musculus) 6480464 Phenobarbital results in increased expression of USP14 mRNA CTD PMID:25270620 Usp14 Rat phlorizin decreases expression ISO Usp14 (Mus musculus) 6480464 Phlorhizin results in decreased expression of USP14 mRNA CTD PMID:22538082 Usp14 Rat pirinixic acid multiple interactions ISO Usp14 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of USP14 mRNA] CTD PMID:21318169 Usp14 Rat pirinixic acid increases expression ISO Usp14 (Mus musculus) 6480464 pirinixic acid results in increased expression of USP14 mRNA CTD PMID:15375163 more ... Usp14 Rat propiconazole increases expression ISO Usp14 (Mus musculus) 6480464 propiconazole results in increased expression of USP14 mRNA CTD PMID:21278054 Usp14 Rat quercetin increases phosphorylation ISO USP14 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of USP14 protein CTD PMID:35688186 Usp14 Rat sarin decreases expression ISO USP14 (Homo sapiens) 6480464 Sarin results in decreased expression of USP14 mRNA CTD PMID:19522546 Usp14 Rat silver atom increases expression ISO Usp14 (Mus musculus) 6480464 Silver results in increased expression of USP14 mRNA CTD PMID:27131904 Usp14 Rat silver(0) increases expression ISO Usp14 (Mus musculus) 6480464 Silver results in increased expression of USP14 mRNA CTD PMID:27131904 Usp14 Rat sodium arsenate increases expression ISO Usp14 (Mus musculus) 6480464 sodium arsenate results in increased expression of USP14 mRNA CTD PMID:30953684 Usp14 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of USP14 protein CTD PMID:29459688 Usp14 Rat sodium arsenite multiple interactions ISO USP14 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of USP14 mRNA CTD PMID:39836092 Usp14 Rat sodium dichromate increases expression ISO Usp14 (Mus musculus) 6480464 sodium bichromate results in increased expression of USP14 mRNA CTD PMID:22155349 Usp14 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of USP14 mRNA CTD PMID:22561333 Usp14 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of USP14 mRNA CTD PMID:30047161 Usp14 Rat tebufenpyrad decreases expression ISO USP14 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of USP14 mRNA CTD PMID:33512557 Usp14 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of USP14 mRNA] CTD PMID:31150632 Usp14 Rat tetrachloromethane increases expression ISO Usp14 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of USP14 mRNA CTD PMID:31919559 Usp14 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of USP14 mRNA CTD PMID:31150632 Usp14 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of USP14 mRNA CTD PMID:34492290 Usp14 Rat titanium dioxide decreases methylation ISO Usp14 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP14 gene CTD PMID:35295148 Usp14 Rat trichloroethene affects expression ISO Usp14 (Mus musculus) 6480464 Trichloroethylene affects the expression of USP14 mRNA CTD PMID:21135412 Usp14 Rat triphenyl phosphate affects expression ISO USP14 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP14 mRNA CTD PMID:37042841 Usp14 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of USP14 mRNA CTD PMID:24136188 Usp14 Rat valproic acid increases expression ISO USP14 (Homo sapiens) 6480464 Valproic Acid results in increased expression of USP14 mRNA CTD PMID:19101580 and PMID:23179753 Usp14 Rat valproic acid affects expression ISO USP14 (Homo sapiens) 6480464 Valproic Acid affects the expression of USP14 mRNA CTD PMID:25979313
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1H-pyrazole (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzatropine (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) Bisphenol B (ISO) butanal (ISO) butane-2,3-dione (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) deoxycholic acid (ISO) dibutyl phthalate (EXP) doxorubicin (ISO) ethanol (EXP,ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) Heptachlor epoxide (ISO) ivermectin (ISO) leflunomide (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nefazodone (EXP) nimesulide (EXP) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenethyl isothiocyanate (ISO) phenobarbital (ISO) phlorizin (ISO) pirinixic acid (ISO) propiconazole (ISO) quercetin (ISO) sarin (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP,ISO) sulfadimethoxine (EXP) tebufenpyrad (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) valdecoxib (EXP) valproic acid (ISO)
Usp14 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 1,292,745 - 1,330,867 (-) NCBI GRCr8 mRatBN7.2 18 1,018,111 - 1,057,727 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 1,019,400 - 1,057,519 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 1,247,719 - 1,285,312 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 2,035,549 - 2,073,143 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 1,249,617 - 1,287,210 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 1,178,785 - 1,216,573 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 1,178,787 - 1,216,409 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 1,220,909 - 1,259,524 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 1,292,799 - 1,330,478 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 1,292,800 - 1,330,478 (-) NCBI Celera 18 913,079 - 950,655 (-) NCBI Celera Cytogenetic Map 18 p13 NCBI
USP14 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 158,557 - 214,629 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 158,383 - 214,629 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 158,557 - 214,629 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 148,483 - 203,739 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 148,552 - 202,601 NCBI Celera 18 38,469 - 88,896 (+) NCBI Celera Cytogenetic Map 18 p11.32 NCBI HuRef 18 118,287 - 173,451 (+) NCBI HuRef CHM1_1 18 158,444 - 213,016 (+) NCBI CHM1_1 T2T-CHM13v2.0 18 312,304 - 368,380 (+) NCBI T2T-CHM13v2.0
Usp14 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 9,993,615 - 10,030,149 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 9,993,066 - 10,045,119 (-) Ensembl GRCm39 Ensembl GRCm38 18 9,993,615 - 10,030,149 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 9,993,066 - 10,045,119 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 9,993,613 - 10,030,147 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 9,993,064 - 10,030,139 (-) NCBI MGSCv36 mm8 Celera 18 10,022,974 - 10,059,625 (-) NCBI Celera Cytogenetic Map 18 A1 NCBI cM Map 18 4.91 NCBI
Usp14 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 9,710,080 - 9,743,077 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 9,710,080 - 9,737,601 (-) NCBI ChiLan1.0 ChiLan1.0
USP14 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 38,281,859 - 38,335,420 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 23,974,794 - 24,027,995 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 14,104,754 - 14,158,402 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 17,742,463 - 17,797,381 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 17,745,733 - 17,797,070 (-) Ensembl panpan1.1 panPan2
USP14 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 67,035,774 - 67,080,082 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 67,035,843 - 67,079,465 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 66,489,350 - 66,533,765 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 67,100,424 - 67,145,336 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 67,100,585 - 67,145,570 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 66,764,698 - 66,809,563 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 66,789,150 - 66,833,940 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 67,091,118 - 67,135,842 (+) NCBI UU_Cfam_GSD_1.0
Usp14
USP14
USP14 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 59,568,934 - 59,622,467 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 59,568,844 - 59,621,476 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 34,358,982 - 34,414,978 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp14
.
Predicted Target Of
Count of predictions: 403 Count of miRNA genes: 227 Interacting mature miRNAs: 275 Transcripts: ENSRNOT00000020537 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
9589153 Insul31 Insulin level QTL 31 7.15 0.05 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 18 1 42547119 Rat 2312598 Bp340 Blood pressure QTL 340 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 1 30558703 Rat 2300180 Bmd67 Bone mineral density QTL 67 4.8 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 18 1 34291613 Rat 8552968 Pigfal19 Plasma insulin-like growth factor 1 level QTL 19 11.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 18 1 25758124 Rat 9590248 Scort10 Serum corticosterone level QTL 10 19.71 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 1 25758124 Rat 61388 Bp2 Blood pressure QTL 2 3.23 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 1 35374722 Rat 2293661 Bss50 Bone structure and strength QTL 50 4.64 0.0003 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 18 1 34291613 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020537 ⟹ ENSRNOP00000020537
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 1,019,915 - 1,057,508 (-) Ensembl Rnor_6.0 Ensembl 18 1,178,787 - 1,216,379 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084613 ⟹ ENSRNOP00000069634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 1,019,400 - 1,057,519 (-) Ensembl Rnor_6.0 Ensembl 18 1,179,282 - 1,216,409 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095082 ⟹ ENSRNOP00000080597
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 1,019,909 - 1,053,096 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106357 ⟹ ENSRNOP00000084860
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 1,019,400 - 1,053,096 (-) Ensembl
RefSeq Acc Id:
NM_001008301 ⟹ NP_001008302
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 1,292,745 - 1,330,336 (-) NCBI mRatBN7.2 18 1,019,912 - 1,057,506 (-) NCBI Rnor_6.0 18 1,178,785 - 1,216,379 (-) NCBI Rnor_5.0 18 1,220,909 - 1,259,524 (-) NCBI RGSC_v3.4 18 1,292,799 - 1,330,478 (-) RGD Celera 18 913,079 - 950,655 (-) RGD
Sequence:
CGCACCGGAGCTGCCGCTACCACTGCGCTTCCTCTCCGGCCGGCTCCGCAAGCTGCTTCATATACCTCGGCTGCCCTTGTCAGGCCCAGCCTCCCGCGCCGTTTCTTCCCTCCTGCCTCGCCATGCCA
hide sequence
RefSeq Acc Id:
XM_006254396 ⟹ XP_006254458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 1,292,745 - 1,330,867 (-) NCBI mRatBN7.2 18 1,018,111 - 1,057,727 (-) NCBI Rnor_6.0 18 1,178,785 - 1,216,573 (-) NCBI Rnor_5.0 18 1,220,909 - 1,259,524 (-) NCBI
Sequence:
CGTCCAGGCTCCACCTCCACTTTGGCCCGCCTGGCCAGCCTCTCCCTTTTTCCCCCTACCTCCAGGCCCCGCCTCTGCCCCGTGCTGCACTCCCCGCACTTCCTCGCCTCCCCCCTGCCCCCAACCGC
hide sequence
RefSeq Acc Id:
XM_006254398 ⟹ XP_006254460
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 1,292,745 - 1,330,798 (-) NCBI mRatBN7.2 18 1,018,112 - 1,057,727 (-) NCBI Rnor_6.0 18 1,178,785 - 1,216,544 (-) NCBI Rnor_5.0 18 1,220,909 - 1,259,524 (-) NCBI
Sequence:
CCTGGCCAGCCTCTCCCTTTTTCCCCCTACCTCCAGGCCCCGCCTCTGCCCCGTGCTGCACTCC
hide sequence
RefSeq Acc Id:
XM_063277272 ⟹ XP_063133342
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 1,292,745 - 1,330,733 (-) NCBI
RefSeq Acc Id:
NP_001008302 ⟸ NM_001008301
- UniProtKB:
Q5U2N2 (UniProtKB/TrEMBL), A0A8I5ZY29 (UniProtKB/TrEMBL)
- Sequence:
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLATAMELPCGLTNLGNTCYMNATVQCIRSVPE
hide sequence
RefSeq Acc Id:
XP_006254458 ⟸ XM_006254396
- Peptide Label:
isoform X1
- UniProtKB:
Q5U2N2 (UniProtKB/TrEMBL), A0A8I5ZY29 (UniProtKB/TrEMBL)
- Sequence:
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLATAMELPCGLTNLGNTCYMNATVQCIRSVPE
hide sequence
RefSeq Acc Id:
XP_006254460 ⟸ XM_006254398
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZR30 (UniProtKB/TrEMBL)
- Sequence:
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKMKNMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSM
hide sequence
Ensembl Acc Id:
ENSRNOP00000069634 ⟸ ENSRNOT00000084613
Ensembl Acc Id:
ENSRNOP00000020537 ⟸ ENSRNOT00000020537
Ensembl Acc Id:
ENSRNOP00000080597 ⟸ ENSRNOT00000095082
Ensembl Acc Id:
ENSRNOP00000084860 ⟸ ENSRNOT00000106357
RefSeq Acc Id:
XP_063133342 ⟸ XM_063277272
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZR30 (UniProtKB/TrEMBL)
RGD ID: 13700628 Promoter ID: EPDNEW_R11152 Type: initiation region Name: Usp14_1 Description: ubiquitin specific peptidase 14 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 1,216,361 - 1,216,421 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-01
Usp14
ubiquitin specific peptidase 14
Usp14
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-02-02
Usp14
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Usp14
ubiquitin specific peptidase 14
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Usp14
ubiquitin specific peptidase 14
Usp14
ubiquitin specific protease 14
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Usp14
ubiquitin specific protease 14
Usp14_predicted
ubiquitin specific protease 14 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Usp14_predicted
ubiquitin specific protease 14 (predicted)
Symbol and Name status set to approved
70820 APPROVED
