Gadd45g (growth arrest and DNA-damage-inducible, gamma)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gadd45g (growth arrest and DNA-damage-inducible, gamma) Rattus norvegicus

Analyze

Symbol:

Gadd45g

Name:

growth arrest and DNA-damage-inducible, gamma

RGD ID:

1311796

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in several processes, including positive regulation of apoptotic process; positive regulation of cold-induced thermogenesis; and positive regulation of stress-activated MAPK cascade. Predicted to act upstream of or within positive regulation of MAPK cascade. Predicted to be active in cytoplasm and nucleus. Biomarker of mesangial proliferative glomerulonephritis. Orthologous to human GADD45G (growth arrest and DNA damage inducible gamma); PARTICIPATES IN interleukin-12 signaling pathway; p38 MAPK signaling pathway; cell cycle pathway, mitotic; INTERACTS WITH (S)-colchicine; 1,3-dinitrobenzene; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GADD45gamma; growth arrest and DNA damage inducible; growth arrest and DNA damage-inducible protein GADD45 gamma; growth arrest and DNA-damage-inducible 45 gamma; growth arrest and DNA-damage-inducible protein GADD45 gamma; LOC291005

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	13,376,842 - 13,378,587 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	13,376,839 - 13,378,610 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	13,306,579 - 13,308,325 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	14,916,605 - 14,918,351 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	13,233,590 - 13,235,336 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	13,391,474 - 13,393,219 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	13,391,467 - 13,393,243 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	15,469,297 - 15,471,042 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	19,230,896 - 19,232,641 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	19,230,892 - 19,312,040 (-)	NCBI
Celera	17	13,134,806 - 13,136,551 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

mesangial proliferative glomerulonephritis (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(1->4)-beta-D-glucan (ISO)

(S)-colchicine (EXP)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO)

1,1-dichloroethene (ISO)

1,3-dinitrobenzene (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-butoxyethanol (ISO)

2-nitropropane (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-phenylcoumarin (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenic trichloride (ISO)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

biphenyl-4-amine (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

Brevetoxin B (ISO)

bromobenzene (EXP)

buspirone (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

camptothecin (ISO)

cannabidiol (ISO)

captan (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

carbonyl sulfide (EXP)

CGP 52608 (ISO)

chlordecone (ISO)

chloroprene (ISO)

chlorpyrifos (EXP,ISO)

cholesterol (ISO)

choline (ISO)

ciglitazone (EXP)

ciguatoxin CTX1B (ISO)

cisplatin (EXP,ISO)

clofibrate (EXP,ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

cyanocob(III)alamin (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

dexamethasone (ISO)

diazinon (EXP)

dibutyl phthalate (EXP,ISO)

diclofenac (ISO)

dieldrin (EXP)

diethyl maleate (ISO)

diethylstilbestrol (EXP)

dimethyl sulfoxide (EXP)

dioxygen (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

febuxostat (ISO)

fenpyroximate (ISO)

fluoranthene (ISO)

folic acid (ISO)

folpet (ISO)

fonofos (ISO)

furan (EXP)

gefitinib (ISO)

genistein (ISO)

gentamycin (EXP)

glucose (ISO)

glycidol (EXP)

glycine betaine (ISO)

glyphosate (EXP,ISO)

graphene oxide (ISO)

hydrogen cyanide (ISO)

hydrogen sulfide (ISO)

hypochlorous acid (ISO)

idarubicin (ISO)

imidacloprid (EXP)

indole-3-methanol (EXP)

inulin (ISO)

irinotecan (EXP)

isoprenaline (ISO)

kainic acid (ISO)

L-methionine (ISO)

lead diacetate (EXP)

methamphetamine (EXP)

methotrexate (ISO)

methoxychlor (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

methylmercury(1+) (EXP)

miconazole (ISO)

microcystin-LR (ISO)

milrinone (EXP)

myristicin (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-nitrosodiethylamine (EXP,ISO)

neomycin (ISO)

nickel dichloride (EXP)

nimesulide (EXP)

nitrofen (EXP)

ochratoxin A (ISO)

orphenadrine (EXP)

oxaliplatin (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

parathion (ISO)

pentanal (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenformin (EXP)

phenobarbital (EXP,ISO)

phenylmercury acetate (ISO)

phosgene (ISO)

phosphoramide mustard (EXP)

pirinixic acid (ISO)

potassium cyanide (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

propanal (ISO)

reactive oxygen species (ISO)

resveratrol (EXP,ISO)

ritodrine (ISO)

rotenone (EXP)

Salinomycin (ISO)

SB 431542 (ISO)

SCH 23390 (EXP)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

Soman (EXP)

sorafenib (ISO)

sunitinib (ISO)

T-2 toxin (EXP)

tamoxifen (ISO)

terbufos (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thapsigargin (ISO)

thiabendazole (EXP)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

topotecan (EXP)

tributylstannane (ISO)

trichloroethene (EXP)

triclosan (ISO)

Triptolide (EXP)

trovafloxacin (EXP,ISO)

tunicamycin (ISO)

valproic acid (ISO)

vincaleukoblastine (EXP)

vinclozolin (EXP)

vincristine (EXP)

Xanthatin (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

cell differentiation (IEA)

positive regulation of apoptotic process (ISO)

positive regulation of cold-induced thermogenesis (ISO,ISS)

positive regulation of JNK cascade (ISO)

positive regulation of MAPK cascade (ISO)

positive regulation of p38MAPK cascade (ISO)

regulation of cell cycle (IBA,IEA,ISO)

Cellular Component

cytoplasm (IBA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

interleukin-12 signaling pathway (ISO)

mitogen activated protein kinase signaling pathway (IEA)

p38 MAPK signaling pathway (ISO)

p53 signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	GADD45¿ regulates the thermogenic capacity of brown adipose tissue.	Gantner ML, etal., Proc Natl Acad Sci U S A. 2014 Aug 12;111(32):11870-5. doi: 10.1073/pnas.1406638111. Epub 2014 Jul 28.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Gene expression profile and overexpression of apoptosis-related genes (NGFI-B and Gadd 45 gamma) in early phase of Thy-1 nephritis model.	Xu JH, etal., Cell Tissue Res. 2006 Oct;326(1):159-68. doi: 10.1007/s00441-006-0214-4. Epub 2006 May 31.

Additional References at PubMed

PMID:9827804	PMID:10100865	PMID:12124778	PMID:12213961	PMID:12477932	PMID:18445651	PMID:19882653	PMID:27086974	PMID:32828305

Genomics

Comparative Map Data

Gadd45g
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	13,376,842 - 13,378,587 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	13,376,839 - 13,378,610 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	13,306,579 - 13,308,325 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	14,916,605 - 14,918,351 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	13,233,590 - 13,235,336 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	13,391,474 - 13,393,219 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	13,391,467 - 13,393,243 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	15,469,297 - 15,471,042 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	19,230,896 - 19,232,641 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	19,230,892 - 19,312,040 (-)	NCBI
Celera	17	13,134,806 - 13,136,551 (-)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

GADD45G
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	89,605,012 - 89,606,555 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	89,605,012 - 89,606,555 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	92,219,927 - 92,221,470 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	91,409,748 - 91,411,290 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	89,449,481 - 89,451,021	NCBI
Celera	9	62,803,226 - 62,804,769 (+)	NCBI		Celera
Cytogenetic Map	9	q22.2	NCBI
HuRef	9	62,051,611 - 62,053,154 (+)	NCBI		HuRef
CHM1_1	9	92,368,717 - 92,370,261 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	101,768,936 - 101,770,479 (+)	NCBI		T2T-CHM13v2.0

Gadd45g
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	52,000,711 - 52,002,511 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	52,000,714 - 52,002,504 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	51,846,675 - 51,848,475 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	51,846,678 - 51,848,468 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	51,942,044 - 51,943,844 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	51,859,189 - 51,860,971 (+)	NCBI		MGSCv36	mm8
Celera	13	52,922,160 - 52,923,960 (+)	NCBI		Celera
Cytogenetic Map	13	A5	NCBI
cM Map	13	26.36	NCBI

Gadd45g
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955515	2,422,998 - 2,424,851 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955515	2,423,137 - 2,424,851 (-)	NCBI	ChiLan1.0	ChiLan1.0

GADD45G
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	49,856,577 - 49,858,126 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	60,695,307 - 60,696,860 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	88,740,411 - 88,741,965 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	88,740,411 - 88,741,958 (+)	Ensembl	panpan1.1		panPan2

GADD45G
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	96,745,001 - 96,746,535 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	96,744,985 - 96,746,520 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	97,197,788 - 97,199,313 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	97,346,707 - 97,348,232 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	97,346,691 - 97,348,226 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	96,974,994 - 96,976,519 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	96,693,996 - 96,695,522 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	97,452,325 - 97,453,850 (-)	NCBI		UU_Cfam_GSD_1.0

Gadd45g
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	11,357,046 - 11,358,722 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936780	501,681 - 503,305 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936780	501,452 - 503,272 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GADD45G
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	1,165,982 - 1,167,529 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	1,166,000 - 1,167,538 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	1,421,152 - 1,422,690 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GADD45G
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	100,097,990 - 100,099,541 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	100,097,967 - 100,099,697 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	88,422,292 - 88,423,839 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gadd45g
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	22,959,373 - 22,961,491 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624765	22,959,751 - 22,961,371 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gadd45g
5 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	303
Count of miRNA genes:	175
Interacting mature miRNAs:	203
Transcripts:	ENSRNOT00000018252
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22871563	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2115149	21881669	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
631499	Stl1	Serum triglyceride level QTL 1	3.6		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	3271398	27389946	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	17	4299130	21293263	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	4299130	21293263	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4354487	27028127	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4354487	27028127	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1581553	Pur14	Proteinuria QTL 14	5.3	0.0001	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	17	7979968	16317111	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9201365	23653323	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9201365	23653323	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9201365	23653323	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat

Markers in Region

C86281

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	13,376,871 - 13,377,056 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	13,391,504 - 13,391,688	NCBI	Rnor6.0
Rnor_5.0	17	15,469,327 - 15,469,511	UniSTS	Rnor5.0
RGSC_v3.4	17	19,230,926 - 19,231,110	UniSTS	RGSC3.4
Celera	17	13,134,836 - 13,135,020	UniSTS
Cytogenetic Map	17	p14	UniSTS

PMC86941P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	13,377,064 - 13,377,420 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	13,391,697 - 13,392,052	NCBI	Rnor6.0
Rnor_5.0	17	15,469,520 - 15,469,875	UniSTS	Rnor5.0
RGSC_v3.4	17	19,231,119 - 19,231,474	UniSTS	RGSC3.4
Celera	17	13,135,029 - 13,135,384	UniSTS
Cytogenetic Map	17	p14	UniSTS

UniSTS:237015

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	13,376,929 - 13,377,128 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	13,391,562 - 13,391,760	NCBI	Rnor6.0
Rnor_5.0	17	15,469,385 - 15,469,583	UniSTS	Rnor5.0
RGSC_v3.4	17	19,230,984 - 19,231,182	UniSTS	RGSC3.4
Celera	17	13,134,894 - 13,135,092	UniSTS
Cytogenetic Map	17	p14	UniSTS

UniSTS:546781

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	13,377,931 - 13,378,527 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	13,392,564 - 13,393,159	NCBI	Rnor6.0
Rnor_5.0	17	15,470,387 - 15,470,982	UniSTS	Rnor5.0
Celera	17	13,135,896 - 13,136,491	UniSTS
Cytogenetic Map	17	p14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	36	24	19	3	19	2	5	58	29	34	11	2
Low		7	33	22	16	22	6	6	16	6	7		6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001077640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB020978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000287	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MW396346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000018252 ⟹ ENSRNOP00000018251

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	13,376,839 - 13,378,610 (-)	Ensembl
Rnor_6.0 Ensembl	17	13,391,467 - 13,393,243 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106900 ⟹ ENSRNOP00000086432

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	13,376,839 - 13,378,610 (-)	Ensembl

RefSeq Acc Id:

NM_001077640 ⟹ NP_001071108

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	13,376,842 - 13,378,587 (-)	NCBI
Rnor_6.0	17	13,391,474 - 13,393,219 (-)	NCBI
Rnor_5.0	17	15,469,297 - 15,471,042 (-)	NCBI
RGSC_v3.4	17	19,230,896 - 19,232,641 (-)	RGD
Celera	17	13,134,806 - 13,136,551 (-)	RGD

Sequence:

show sequence

CGCGGATCGTCTTTGGGAATCTTTACTTGCCCTCGGGTTCCCTCTGCACTCTTCACTTTTGGAT
AACTTGCTGTTCGTGGATCGCACAATGACTCTGGAAGAAGTCCGTGGCCAGGATACAGTTCCGG
AAAGCACAGCCAGGATGCAGGGCGCCGGGAAAGCATTGCACGAACTTCTGCTGTCGGCGCAGCG
CCAGGGCTGTCTGACCGCTGGCGTCTACGAGTCCGCCAAAGTCCTGAATGTGGACCCTGACAAT
GTGACCTTTTGCGTGCTGGCTGCCGACGAAGAAGATGAGGGCGACATAGCCCTGCAGATCCATT
TTACGTTGATCCAGGCGTTCTGCTGCGAGAACGACATTGACATCGTGCGCGTGGGAGACGTGCA
GAGGCTGGCGGCGATCGTGGGCGCCGACGACGAGGGGGGCGCGCCGGGAGACTTGCATTGCATC
CTCATTTCGAACCCTAATGAAGACACATGGAAGGACCCTGCCTTGGAGAAGCTCAGTTTGTTCT
GCGAGGAGAGCCGCAGCTTCAACGACTGGGTGCCCAGCATCACCCTTCCCGAGTGACAGCCTGG
CAGGGACCTTGGTCTGATCGACTTGGTGACACTCTAGCGCGCTGCTGGCTCTGGAGTGGCCCTC
CGAGGGCGCTCGAGTGCGCATGGAGACTGGCAGGCGATGTTGCCTGGAGAGCGAGGAGCGCGGC
CTCCCAAGAAGGGGGTCTGGCGGCAGCGGGGACATCCTGTTCCGAGCCCAGGACTCTGCCAGTG
TCCGGAGAGGCTGCTAGCACACGAAGGCCTAGGCAAGGACGTTGGCCCCAGGGCCGGGAAGAAC
CGACCAGCGAGGCAGGTGTGACTCAGCAAGCAGCCTTCAGTGAAAGGAGGGGAAAGGCAAGGCA
GGAGGCCGCCTGGACTTGGTACAGCTGCAGGAGAGGCCACTGCAGGAGCGAGCCGGACTTAGCA
AGACTGCACTGCTCTTTCAAAAACGGATCTCCTGGGCAATTGCTTTCATTTTCTAAAGGACGCT
ATCGTGGAAGCTTTGAATTTCACAATAAACTTATTGAAAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001071108	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68643	(Get FASTA)	NCBI Sequence Viewer
	BAA78094	(Get FASTA)	NCBI Sequence Viewer
	EDL98082	(Get FASTA)	NCBI Sequence Viewer
	Q9WTQ7	(Get FASTA)	NCBI Sequence Viewer
	QST78375	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001071108 ⟸ NM_001077640
- UniProtKB:	Q9WTQ7 (UniProtKB/Swiss-Prot), B5DEF0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAA DEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGADDEGGAPGDLHCILISNPNED TWKDPALEKLSLFCEESRSFNDWVPSITLPE hide sequence

RefSeq Acc Id:

ENSRNOP00000018251 ⟸ ENSRNOT00000018252

RefSeq Acc Id:

ENSRNOP00000086432 ⟸ ENSRNOT00000106900

Protein Domains

Ribosomal protein L7Ae/L30e/S12e/Gadd45

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9WTQ7-F1-model_v2	AlphaFold	Q9WTQ7	1-159	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311796	AgrOrtholog
BioCyc Gene	G2FUF-10076	BioCyc
Ensembl Genes	ENSRNOG00000013090	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000018251	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000086432.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018252	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000106900.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.1330.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GADD45	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	L30e-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L7Ae/L30e/S12e/Gad45	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:291005	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	291005	ENTREZGENE
PANTHER	GROWTH ARREST AND DNA DAMAGE-INDUCIBLE PROTEIN GADD45 GAMMA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10411	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ribosomal_L7Ae	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gadd45g	PhenoGen
Superfamily-SCOP	SSF55315	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A8S9_RAT	UniProtKB/TrEMBL
	B5DEF0	ENTREZGENE, UniProtKB/TrEMBL
	GA45G_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-14	Gadd45g	growth arrest and DNA-damage-inducible, gamma	Gadd45g	growth arrest and DNA-damage-inducible 45 gamma	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Gadd45g	growth arrest and DNA-damage-inducible 45 gamma	Gadd45g_predicted	growth arrest and DNA-damage-inducible 45 gamma (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gadd45g_predicted	growth arrest and DNA-damage-inducible 45 gamma (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)