Symbol:
Btbd3
Name:
BTB domain containing 3
RGD ID:
1311623
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in cerebral cortex development and dendrite morphogenesis. Predicted to be located in nucleus. Predicted to be active in cytosol. Orthologous to human BTBD3 (BTB domain containing 3); INTERACTS WITH 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BTB (POZ) domain containing 3; BTB/POZ domain-containing protein 3; LOC311462
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 146,044,053 - 146,074,189 (+) NCBI GRCr8 mRatBN7.2 3 125,591,427 - 125,621,660 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 125,591,490 - 125,619,038 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 129,492,602 - 129,498,944 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 138,069,602 - 138,075,944 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 135,758,994 - 135,765,335 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 131,330,338 - 131,360,554 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 131,351,587 - 131,357,929 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 137,786,843 - 137,834,225 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 126,403,030 - 126,409,372 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 126,269,005 - 126,314,948 (+) NCBI Celera 3 124,316,863 - 124,323,205 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Btbd3 Rat 17beta-estradiol affects expression ISO RGD:1323177 6480464 Estradiol affects the expression of BTBD3 mRNA CTD PMID:14699072 Btbd3 Rat 17beta-estradiol multiple interactions ISO RGD:1323177 6480464 [Estradiol co-treated with Progesterone] results in increased expression of BTBD3 mRNA CTD PMID:20660070 Btbd3 Rat 17beta-estradiol 3-benzoate increases methylation EXP 6480464 estradiol 3-benzoate results in increased methylation of BTBD3 promoter CTD PMID:27415467 Btbd3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1323178 6480464 Tetrachlorodibenzodioxin affects the expression of BTBD3 mRNA CTD PMID:21570461 Btbd3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of BTBD3 mRNA CTD PMID:34747641 Btbd3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of BTBD3 mRNA CTD PMID:21346803 Btbd3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of BTBD3 mRNA CTD PMID:21346803 Btbd3 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1323178 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of BTBD3 mRNA CTD PMID:26251327 Btbd3 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1323178 6480464 4,4'-diaminodiphenylmethane results in decreased expression of BTBD3 mRNA CTD PMID:18648102 Btbd3 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1323178 6480464 Fenretinide results in increased expression of BTBD3 mRNA CTD PMID:28973697 Btbd3 Rat acrolein multiple interactions ISO RGD:1323177 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268|PMID:32845096 Btbd3 Rat aflatoxin B1 decreases methylation ISO RGD:1323177 6480464 Aflatoxin B1 results in decreased methylation of BTBD3 gene CTD PMID:27153756 Btbd3 Rat alpha-pinene multiple interactions ISO RGD:1323177 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Btbd3 Rat aristolochic acid A decreases expression ISO RGD:1323177 6480464 aristolochic acid I results in decreased expression of BTBD3 mRNA CTD PMID:33212167 Btbd3 Rat arsane increases methylation ISO RGD:1323177 6480464 Arsenic results in increased methylation of BTBD3 promoter CTD PMID:21291286 Btbd3 Rat arsane multiple interactions ISO RGD:1323177 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Btbd3 Rat arsenic atom increases methylation ISO RGD:1323177 6480464 Arsenic results in increased methylation of BTBD3 promoter CTD PMID:21291286 Btbd3 Rat arsenic atom multiple interactions ISO RGD:1323177 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Btbd3 Rat arsenite(3-) multiple interactions ISO RGD:1323177 6480464 arsenite inhibits the reaction [G3BP1 protein binds to BTBD3 mRNA] CTD PMID:32406909 Btbd3 Rat arsenous acid decreases expression ISO RGD:1323177 6480464 Arsenic Trioxide results in decreased expression of BTBD3 mRNA CTD PMID:15725085 Btbd3 Rat benzo[a]pyrene decreases expression ISO RGD:1323178 6480464 Benzo(a)pyrene results in decreased expression of BTBD3 mRNA CTD PMID:19770486|PMID:22228805 Btbd3 Rat benzo[a]pyrene affects methylation ISO RGD:1323177 6480464 Benzo(a)pyrene affects the methylation of BTBD3 5' UTR; Benzo(a)pyrene affects the methylation of BTBD3 promoter CTD PMID:27901495|PMID:30157460 Btbd3 Rat benzo[a]pyrene increases methylation ISO RGD:1323177 6480464 Benzo(a)pyrene results in increased methylation of BTBD3 promoter CTD PMID:27901495 Btbd3 Rat benzo[a]pyrene decreases methylation ISO RGD:1323177 6480464 Benzo(a)pyrene results in decreased methylation of BTBD3 exon CTD PMID:27901495 Btbd3 Rat benzo[e]pyrene increases methylation ISO RGD:1323177 6480464 benzo(e)pyrene results in increased methylation of BTBD3 promoter CTD PMID:30157460 Btbd3 Rat beta-lapachone decreases expression ISO RGD:1323177 6480464 beta-lapachone results in decreased expression of BTBD3 mRNA CTD PMID:38218311 Btbd3 Rat bicalutamide increases expression ISO RGD:1323177 6480464 bicalutamide results in increased expression of BTBD3 mRNA CTD PMID:16631469 Btbd3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1323178 6480464 Diethylhexyl Phthalate results in decreased expression of BTBD3 mRNA CTD PMID:34319233 Btbd3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BTBD3 mRNA CTD PMID:34947998|PMID:38750585 Btbd3 Rat carbon nanotube decreases expression ISO RGD:1323178 6480464 Nanotubes, Carbon analog results in decreased expression of BTBD3 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Btbd3 Rat CGP 52608 multiple interactions ISO RGD:1323177 6480464 CGP 52608 promotes the reaction [RORA protein binds to BTBD3 gene] CTD PMID:28238834 Btbd3 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of BTBD3 mRNA CTD PMID:30556269 Btbd3 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of BTBD3 mRNA CTD PMID:30556269 Btbd3 Rat copper(II) sulfate increases expression ISO RGD:1323177 6480464 Copper Sulfate results in increased expression of BTBD3 mRNA CTD PMID:19549813 Btbd3 Rat cyclosporin A increases expression ISO RGD:1323177 6480464 Cyclosporine results in increased expression of BTBD3 mRNA CTD PMID:25562108 Btbd3 Rat diarsenic trioxide decreases expression ISO RGD:1323177 6480464 Arsenic Trioxide results in decreased expression of BTBD3 mRNA CTD PMID:15725085 Btbd3 Rat ethanol affects splicing ISO RGD:1323178 6480464 Ethanol affects the splicing of BTBD3 mRNA CTD PMID:30319688 Btbd3 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of BTBD3 mRNA CTD PMID:31881178 Btbd3 Rat gallic acid decreases expression ISO RGD:1323177 6480464 Gallic Acid results in decreased expression of BTBD3 mRNA CTD PMID:34408198 Btbd3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BTBD3 mRNA CTD PMID:33387578 Btbd3 Rat irinotecan decreases expression ISO RGD:1323177 6480464 Irinotecan analog results in decreased expression of BTBD3 mRNA CTD PMID:18927307 Btbd3 Rat isotretinoin increases expression ISO RGD:1323177 6480464 Isotretinoin results in increased expression of BTBD3 mRNA CTD PMID:20436886 Btbd3 Rat levonorgestrel multiple interactions ISO RGD:1323177 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of BTBD3 mRNA CTD PMID:19074003 Btbd3 Rat maneb multiple interactions ISO RGD:1323178 6480464 [Maneb co-treated with Paraquat] results in decreased expression of BTBD3 mRNA; [Maneb co-treated with Paraquat] more ... CTD PMID:36117858 Btbd3 Rat manganese atom multiple interactions ISO RGD:1323177 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Btbd3 Rat manganese(0) multiple interactions ISO RGD:1323177 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Btbd3 Rat manganese(II) chloride multiple interactions ISO RGD:1323177 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Btbd3 Rat methapyrilene increases methylation ISO RGD:1323177 6480464 Methapyrilene results in increased methylation of BTBD3 promoter CTD PMID:30157460 Btbd3 Rat methotrexate affects response to substance ISO RGD:1323177 6480464 BTBD3 protein affects the susceptibility to Methotrexate CTD PMID:16217747 Btbd3 Rat mitoxantrone affects response to substance ISO RGD:1323177 6480464 BTBD3 protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Btbd3 Rat nickel sulfate decreases expression ISO RGD:1323177 6480464 nickel sulfate results in decreased expression of BTBD3 mRNA CTD PMID:22714537 Btbd3 Rat okadaic acid increases expression ISO RGD:1323177 6480464 Okadaic Acid results in increased expression of BTBD3 mRNA CTD PMID:38832940 Btbd3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of BTBD3 mRNA CTD PMID:25729387 Btbd3 Rat ozone multiple interactions ISO RGD:1323177 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268|PMID:32845096 Btbd3 Rat ozone multiple interactions ISO RGD:1323178 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Btbd3 Rat paraquat multiple interactions ISO RGD:1323178 6480464 [Maneb co-treated with Paraquat] results in decreased expression of BTBD3 mRNA; [Maneb co-treated with Paraquat] more ... CTD PMID:36117858 Btbd3 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1323178 6480464 perfluorohexanesulfonic acid results in increased expression of BTBD3 mRNA CTD PMID:37995155 Btbd3 Rat progesterone multiple interactions ISO RGD:1323177 6480464 [Estradiol co-treated with Progesterone] results in increased expression of BTBD3 mRNA CTD PMID:20660070 Btbd3 Rat resveratrol multiple interactions ISO RGD:1323177 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of BTBD3 mRNA CTD PMID:23557933 Btbd3 Rat sodium arsenite decreases expression ISO RGD:1323177 6480464 sodium arsenite results in decreased expression of BTBD3 mRNA CTD PMID:22714537 Btbd3 Rat sodium arsenite multiple interactions ISO RGD:1323177 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Btbd3 Rat temozolomide increases expression ISO RGD:1323177 6480464 Temozolomide results in increased expression of BTBD3 mRNA CTD PMID:31758290 Btbd3 Rat testosterone undecanoate multiple interactions ISO RGD:1323177 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of BTBD3 mRNA CTD PMID:19074003 Btbd3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BTBD3 mRNA CTD PMID:23411599|PMID:34492290 Btbd3 Rat titanium dioxide decreases expression ISO RGD:1323178 6480464 titanium dioxide results in decreased expression of BTBD3 mRNA CTD PMID:29264374 Btbd3 Rat titanium dioxide decreases methylation ISO RGD:1323178 6480464 titanium dioxide results in decreased methylation of BTBD3 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Btbd3 Rat titanium dioxide increases methylation ISO RGD:1323178 6480464 titanium dioxide results in increased methylation of BTBD3 gene CTD PMID:35295148 Btbd3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of BTBD3 mRNA CTD PMID:25729387 Btbd3 Rat triphenyl phosphate affects expression ISO RGD:1323177 6480464 triphenyl phosphate affects the expression of BTBD3 mRNA CTD PMID:37042841 Btbd3 Rat urethane increases expression ISO RGD:1323177 6480464 Urethane results in increased expression of BTBD3 mRNA CTD PMID:28818685 Btbd3 Rat valproic acid affects expression ISO RGD:1323178 6480464 Valproic Acid affects the expression of BTBD3 mRNA CTD PMID:17963808 Btbd3 Rat valproic acid increases expression ISO RGD:1323177 6480464 Valproic Acid results in increased expression of BTBD3 mRNA CTD PMID:29154799 Btbd3 Rat valproic acid decreases expression ISO RGD:1323177 6480464 Valproic Acid results in decreased expression of BTBD3 mRNA CTD PMID:23179753 Btbd3 Rat valproic acid affects expression ISO RGD:1323177 6480464 Valproic Acid affects the expression of BTBD3 mRNA CTD PMID:25979313
Btbd3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 146,044,053 - 146,074,189 (+) NCBI GRCr8 mRatBN7.2 3 125,591,427 - 125,621,660 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 125,591,490 - 125,619,038 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 129,492,602 - 129,498,944 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 138,069,602 - 138,075,944 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 135,758,994 - 135,765,335 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 131,330,338 - 131,360,554 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 131,351,587 - 131,357,929 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 137,786,843 - 137,834,225 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 126,403,030 - 126,409,372 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 126,269,005 - 126,314,948 (+) NCBI Celera 3 124,316,863 - 124,323,205 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
BTBD3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 11,890,817 - 11,926,595 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 11,890,723 - 11,926,609 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 11,871,465 - 11,907,243 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 11,819,477 - 11,855,243 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 11,819,476 - 11,855,243 NCBI Celera 20 11,941,645 - 11,977,412 (+) NCBI Celera Cytogenetic Map 20 p12.2 NCBI HuRef 20 11,822,969 - 11,858,736 (+) NCBI HuRef CHM1_1 20 11,871,515 - 11,907,292 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 11,934,110 - 11,969,888 (+) NCBI T2T-CHM13v2.0
Btbd3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 138,098,478 - 138,129,344 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 138,098,485 - 138,431,212 (+) Ensembl GRCm39 Ensembl GRCm38 2 138,256,584 - 138,287,424 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 138,256,565 - 138,589,292 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 138,082,320 - 138,113,158 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 137,948,025 - 137,978,863 (+) NCBI MGSCv36 mm8 Celera 2 139,443,020 - 139,473,880 (+) NCBI Celera Cytogenetic Map 2 F3 NCBI cM Map 2 68.28 NCBI
Btbd3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 21,588,702 - 21,603,378 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 21,588,669 - 21,602,990 (+) NCBI ChiLan1.0 ChiLan1.0
BTBD3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 12,764,665 - 12,800,608 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 12,761,495 - 12,797,438 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 11,837,299 - 11,873,258 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 11,854,386 - 11,863,535 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 11,854,386 - 11,863,535 (+) Ensembl panpan1.1 panPan2
BTBD3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 10,478,635 - 10,512,773 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 10,479,900 - 10,512,185 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 10,296,006 - 10,330,064 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 10,890,522 - 10,924,645 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 10,890,411 - 10,900,313 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 10,496,821 - 10,530,861 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 10,586,244 - 10,620,300 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 10,934,425 - 10,968,558 (-) NCBI UU_Cfam_GSD_1.0
Btbd3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 159,289,722 - 159,331,202 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 7,720,992 - 7,729,654 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 7,721,081 - 7,762,547 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BTBD3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 20,865,757 - 20,878,211 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 20,844,760 - 20,878,217 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 23,430,521 - 23,462,390 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BTBD3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 40,823,452 - 40,859,702 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 40,851,435 - 40,860,168 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 1,031,634 - 1,067,892 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Btbd3
.
Predicted Target Of
Count of predictions: 144 Count of miRNA genes: 94 Interacting mature miRNAs: 111 Transcripts: ENSRNOT00000010835 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH130618
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 125,621,359 - 125,621,516 (+) MAPPER mRatBN7.2 Rnor_6.0 3 131,360,254 - 131,360,410 NCBI Rnor6.0 Rnor_5.0 3 137,833,925 - 137,834,081 UniSTS Rnor5.0 RGSC_v3.4 3 126,411,697 - 126,411,853 UniSTS RGSC3.4 Celera 3 124,325,530 - 124,325,686 UniSTS RH 3.4 Map 3 1144.4 UniSTS Cytogenetic Map 3 q36 UniSTS
RH137300
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 125,618,673 - 125,618,868 (+) MAPPER mRatBN7.2 Rnor_6.0 3 131,357,568 - 131,357,762 NCBI Rnor6.0 Rnor_5.0 3 137,831,239 - 137,831,433 UniSTS Rnor5.0 RGSC_v3.4 3 126,409,011 - 126,409,205 UniSTS RGSC3.4 Celera 3 124,322,844 - 124,323,038 UniSTS RH 3.4 Map 3 1144.0 UniSTS Cytogenetic Map 3 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010835 ⟹ ENSRNOP00000010835
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 125,612,693 - 125,619,035 (+) Ensembl Rnor_6.0 Ensembl 3 131,351,587 - 131,357,929 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114685 ⟹ ENSRNOP00000093542
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 125,591,490 - 125,619,038 (+) Ensembl
RefSeq Acc Id:
NM_001107782 ⟹ NP_001101252
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 146,065,319 - 146,071,661 (+) NCBI mRatBN7.2 3 125,612,693 - 125,619,035 (+) NCBI Rnor_6.0 3 131,351,587 - 131,357,929 (+) NCBI Rnor_5.0 3 137,786,843 - 137,834,225 (+) NCBI RGSC_v3.4 3 126,403,030 - 126,409,372 (+) RGD Celera 3 124,316,863 - 124,323,205 (+) RGD
Sequence:
CACAACTTCGCCGGCTGGCCGCACTGACTCGCTGGGCTCGCCACATCTTGCTAACCTAATTCAGAAAGCAAGCGCCTCGGTTCTCTGTCTGCCTCCTTTGCTCAGCATAAGCTTTCCAGGTGATCCAG
hide sequence
RefSeq Acc Id:
XM_006235099 ⟹ XP_006235161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 146,044,053 - 146,074,189 (+) NCBI mRatBN7.2 3 125,591,427 - 125,621,660 (+) NCBI Rnor_6.0 3 131,330,338 - 131,360,554 (+) NCBI Rnor_5.0 3 137,786,843 - 137,834,225 (+) NCBI
Sequence:
CCGGGAGCGCCTCCCGGCCCCTCCTGGCGCTCGGGCGTGCGTTCACGGTCCCGGGGAGCGTGCCCTGCGTGCGGGTGCCCGCCTCGCCCGCCGGGCTCTGGATCCCTGAGTTCCCGGACCGGGCCAGC
hide sequence
RefSeq Acc Id:
NP_001101252 ⟸ NM_001107782
- UniProtKB:
D3ZJC0 (UniProtKB/TrEMBL), A6HQL4 (UniProtKB/TrEMBL)
- Sequence:
MVDDKEKNMKCLTFFLMLPETVKNRSKKGSKKANSSSGGGSGGSSGSSKLPPVCYEIITLKTKKKKKMAADIFPRKKPANSSSTTVQLQHQHNLCNNNLIPAPNWQGLYPTIRERNAVMFNNDLMADV
hide sequence
RefSeq Acc Id:
XP_006235161 ⟸ XM_006235099
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AIZ4 (UniProtKB/TrEMBL)
- Sequence:
MAADIFPRKKPANSSSTTVQLQHQHNLCNNNLIPAPNWQGLYPTIRERNAVMFNNDLMADVHFV
hide sequence
Ensembl Acc Id:
ENSRNOP00000010835 ⟸ ENSRNOT00000010835
Ensembl Acc Id:
ENSRNOP00000093542 ⟸ ENSRNOT00000114685
RGD ID: 13692467 Promoter ID: EPDNEW_R2991 Type: initiation region Name: Btbd3_1 Description: BTB domain containing 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 131,351,579 - 131,351,639 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Btbd3
BTB domain containing 3
Btbd3
BTB (POZ) domain containing 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Btbd3
BTB (POZ) domain containing 3
Btbd3_predicted
BTB (POZ) domain containing 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Btbd3_predicted
BTB (POZ) domain containing 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
