Symbol:
Exd2
Name:
exonuclease 3'-5' domain containing 2
RGD ID:
1311087
Description:
Predicted to enable 3'-5' exonuclease activity; metal ion binding activity; and protein homodimerization activity. Predicted to be involved in DNA double-strand break processing; double-strand break repair via homologous recombination; and replication fork processing. Predicted to be located in intermediate filament cytoskeleton; mitochondrial outer membrane; and site of DNA damage. Predicted to be active in cytoplasm and nucleus. Orthologous to human EXD2 (exonuclease 3'-5' domain containing 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Exdl2; exonuclease 3''-5'' domain-like 2; exonuclease 3'-5' domain-containing protein 2; LOC362759; RGD1311087; similar to expressed sequence C85658
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 105,847,931 - 105,881,780 (+) NCBI GRCr8 mRatBN7.2 6 100,116,867 - 100,150,452 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 100,116,867 - 100,150,442 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 100,282,295 - 100,316,178 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 100,581,990 - 100,615,873 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 99,957,060 - 99,990,674 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 104,017,620 - 104,051,442 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 104,017,607 - 104,051,446 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 112,192,441 - 112,226,159 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 104,231,115 - 104,265,354 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 104,234,693 - 104,268,073 (+) NCBI Celera 6 97,974,785 - 98,008,358 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Exd2 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552272 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of EXD2 mRNA CTD PMID:36331819 Exd2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1552272 6480464 1,2-Dimethylhydrazine results in decreased expression of EXD2 mRNA CTD PMID:22206623 Exd2 Rat 17beta-estradiol decreases expression ISO RGD:1552272 6480464 Estradiol results in decreased expression of EXD2 mRNA CTD PMID:39298647 Exd2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1552272 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of EXD2 mRNA CTD PMID:31388691 Exd2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of EXD2 mRNA CTD PMID:21215274 Exd2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552272 6480464 Tetrachlorodibenzodioxin affects the expression of EXD2 mRNA CTD PMID:21570461 Exd2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EXD2 mRNA CTD PMID:32109520 Exd2 Rat 2-methylcholine affects expression ISO RGD:1322357 6480464 beta-methylcholine affects the expression of EXD2 mRNA CTD PMID:21179406 Exd2 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of EXD2 protein CTD PMID:34915118 Exd2 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1552272 6480464 bisphenol S results in decreased expression of EXD2 mRNA CTD PMID:39298647 Exd2 Rat acrolein multiple interactions ISO RGD:1322357 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of EXD2 mRNA CTD PMID:32845096 Exd2 Rat benzo[a]pyrene increases expression ISO RGD:1552272 6480464 Benzo(a)pyrene results in increased expression of EXD2 mRNA CTD PMID:22228805 Exd2 Rat beta-lapachone increases expression ISO RGD:1322357 6480464 beta-lapachone results in increased expression of EXD2 mRNA CTD PMID:38218311 Exd2 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1552272 6480464 Diethylhexyl Phthalate results in increased expression of EXD2 mRNA CTD PMID:34319233 Exd2 Rat bisphenol A affects expression ISO RGD:1322357 6480464 bisphenol A affects the expression of EXD2 mRNA CTD PMID:22574217 Exd2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of EXD2 gene CTD PMID:28505145 Exd2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of EXD2 mRNA CTD PMID:25181051 Exd2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of EXD2 mRNA; [bisphenol A co-treated more ... CTD PMID:26496021|PMID:31129395 Exd2 Rat bisphenol A decreases expression ISO RGD:1552272 6480464 bisphenol A results in decreased expression of EXD2 mRNA CTD PMID:26063408 Exd2 Rat cadmium dichloride decreases expression ISO RGD:1322357 6480464 Cadmium Chloride results in decreased expression of EXD2 mRNA CTD PMID:38568856 Exd2 Rat choline multiple interactions ISO RGD:1552272 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Exd2 Rat dibutyl phthalate increases expression ISO RGD:1552272 6480464 Dibutyl Phthalate results in increased expression of EXD2 mRNA CTD PMID:21266533 Exd2 Rat doxorubicin decreases expression ISO RGD:1322357 6480464 Doxorubicin results in decreased expression of EXD2 mRNA CTD PMID:29803840 Exd2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of EXD2 mRNA CTD PMID:24793618 Exd2 Rat folic acid multiple interactions ISO RGD:1552272 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Exd2 Rat inulin multiple interactions ISO RGD:1552272 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of EXD2 mRNA CTD PMID:36331819 Exd2 Rat L-methionine multiple interactions ISO RGD:1552272 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Exd2 Rat lead(0) decreases expression ISO RGD:1322357 6480464 Lead results in decreased expression of EXD2 mRNA CTD PMID:19921347 Exd2 Rat methidathion decreases expression ISO RGD:1552272 6480464 methidathion results in decreased expression of EXD2 mRNA CTD PMID:34813904 Exd2 Rat ozone multiple interactions ISO RGD:1322357 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of EXD2 mRNA; [Air more ... CTD PMID:32845096|PMID:35430440 Exd2 Rat paracetamol decreases expression ISO RGD:1322357 6480464 Acetaminophen results in decreased expression of EXD2 mRNA CTD PMID:21420995 Exd2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of EXD2 mRNA CTD PMID:33387578 Exd2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552272 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of EXD2 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Exd2 Rat perfluorooctanoic acid increases expression ISO RGD:1322357 6480464 perfluorooctanoic acid results in increased expression of EXD2 protein CTD PMID:26879310 Exd2 Rat resveratrol multiple interactions ISO RGD:1322357 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of EXD2 mRNA CTD PMID:23557933 Exd2 Rat sunitinib increases expression ISO RGD:1322357 6480464 Sunitinib results in increased expression of EXD2 mRNA CTD PMID:31533062 Exd2 Rat temozolomide increases expression ISO RGD:1322357 6480464 Temozolomide results in increased expression of EXD2 mRNA CTD PMID:31758290 Exd2 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of EXD2 mRNA CTD PMID:26496021 Exd2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of EXD2 mRNA CTD PMID:23411599 Exd2 Rat thiram decreases expression ISO RGD:1322357 6480464 Thiram results in decreased expression of EXD2 mRNA CTD PMID:38568856 Exd2 Rat titanium dioxide decreases methylation ISO RGD:1552272 6480464 titanium dioxide results in decreased methylation of EXD2 gene CTD PMID:35295148 Exd2 Rat titanium dioxide increases methylation ISO RGD:1552272 6480464 titanium dioxide results in increased methylation of EXD2 gene CTD PMID:35295148 Exd2 Rat torcetrapib increases expression ISO RGD:1322357 6480464 torcetrapib results in increased expression of EXD2 mRNA CTD PMID:23228038 Exd2 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of EXD2 mRNA CTD PMID:31129395 Exd2 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of EXD2 mRNA CTD PMID:31129395 Exd2 Rat triphenyl phosphate affects expression ISO RGD:1322357 6480464 triphenyl phosphate affects the expression of EXD2 mRNA CTD PMID:37042841 Exd2 Rat trovafloxacin decreases expression ISO RGD:1552272 6480464 trovafloxacin results in decreased expression of EXD2 mRNA CTD PMID:35537566 Exd2 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of EXD2 gene CTD PMID:31079544
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) choline (ISO) dibutyl phthalate (ISO) doxorubicin (ISO) flutamide (EXP) folic acid (ISO) inulin (ISO) L-methionine (ISO) lead(0) (ISO) methidathion (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) resveratrol (ISO) sunitinib (ISO) temozolomide (ISO) testosterone (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) tributylstannane (EXP) triphenyl phosphate (ISO) trovafloxacin (ISO) vinclozolin (EXP)
Exd2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 105,847,931 - 105,881,780 (+) NCBI GRCr8 mRatBN7.2 6 100,116,867 - 100,150,452 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 100,116,867 - 100,150,442 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 100,282,295 - 100,316,178 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 100,581,990 - 100,615,873 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 99,957,060 - 99,990,674 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 104,017,620 - 104,051,442 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 104,017,607 - 104,051,446 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 112,192,441 - 112,226,159 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 104,231,115 - 104,265,354 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 104,234,693 - 104,268,073 (+) NCBI Celera 6 97,974,785 - 98,008,358 (+) NCBI Celera Cytogenetic Map 6 q24 NCBI
EXD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 69,191,498 - 69,244,018 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 69,191,498 - 69,244,020 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 69,658,215 - 69,710,735 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 68,746,231 - 68,778,825 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 68,746,230 - 68,778,825 NCBI Celera 14 49,722,349 - 49,774,877 (+) NCBI Celera Cytogenetic Map 14 q24.1 NCBI HuRef 14 49,828,887 - 49,881,419 (+) NCBI HuRef CHM1_1 14 69,596,430 - 69,648,894 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 63,404,602 - 63,457,085 (+) NCBI T2T-CHM13v2.0
Exd2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 80,509,869 - 80,544,909 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 80,509,869 - 80,547,001 (+) Ensembl GRCm39 Ensembl GRCm38 12 80,463,095 - 80,498,135 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 80,463,095 - 80,500,227 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 81,564,082 - 81,599,122 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 81,394,842 - 81,416,970 (+) NCBI MGSCv36 mm8 Celera 12 81,928,182 - 81,963,154 (+) NCBI Celera Cytogenetic Map 12 C3 NCBI cM Map 12 36.73 NCBI
Exd2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955466 1,110,395 - 1,169,242 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955466 1,114,299 - 1,169,124 (-) NCBI ChiLan1.0 ChiLan1.0
EXD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 70,313,041 - 70,366,036 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 69,527,465 - 69,582,549 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 49,783,072 - 49,835,645 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 68,656,455 - 68,708,773 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 68,656,669 - 68,707,834 (+) Ensembl panpan1.1 panPan2
EXD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 43,028,537 - 43,082,038 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 43,042,563 - 43,187,969 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 42,717,745 - 42,773,001 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 43,257,837 - 43,313,332 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 43,257,911 - 43,316,242 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 42,872,325 - 42,927,784 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 42,946,902 - 43,002,520 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 43,306,406 - 43,361,842 (+) NCBI UU_Cfam_GSD_1.0
Exd2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 61,711,892 - 61,758,994 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 12,432,731 - 12,479,876 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 12,432,752 - 12,479,807 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EXD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 92,848,032 - 92,913,771 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 92,847,958 - 92,909,044 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 99,038,091 - 99,131,917 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EXD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 46,431,309 - 46,480,500 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 46,444,282 - 46,482,845 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 34,655,161 - 34,706,362 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Exd2
.
Predicted Target Of
Count of predictions: 495 Count of miRNA genes: 243 Interacting mature miRNAs: 290 Transcripts: ENSRNOT00000033378 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000033378 ⟹ ENSRNOP00000030862
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 100,116,978 - 100,150,442 (+) Ensembl Rnor_6.0 Ensembl 6 104,017,607 - 104,051,446 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094099 ⟹ ENSRNOP00000079247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 100,116,867 - 100,146,009 (+) Ensembl
RefSeq Acc Id:
NM_001108715 ⟹ NP_001102185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 105,848,202 - 105,881,777 (+) NCBI mRatBN7.2 6 100,116,867 - 100,150,444 (+) NCBI Rnor_6.0 6 104,017,889 - 104,051,434 (+) NCBI Rnor_5.0 6 112,192,441 - 112,226,159 (+) NCBI RGSC_v3.4 6 104,231,115 - 104,265,354 (+) RGD Celera 6 97,974,785 - 98,008,358 (+) RGD
Sequence:
ATGGCGCGGCCCACAGGCACACACCACGGGGGTTATATCCTCCTGGCCAGCCACTGGGCCGGAAGTGGCTACGGCTTTTATGCATCCGGGTGGATTGTGGGTCAGTGAAATGCATTCCTAAACAGTGA
hide sequence
RefSeq Acc Id:
XM_006240286 ⟹ XP_006240348
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 105,847,931 - 105,881,780 (+) NCBI mRatBN7.2 6 100,116,901 - 100,150,452 (+) NCBI Rnor_6.0 6 104,017,620 - 104,051,442 (+) NCBI Rnor_5.0 6 112,192,441 - 112,226,159 (+) NCBI
Sequence:
TAAACAGTTTCTTTATTTTCTCGCTCGAATATAAGAAAATTAATGTAATAGAGAAACGCTATCCGGGTTAAAAGAGAAAATGATATGTCTTATGTTGCATTTGTGAGTGAAAGTTCAGTAGGCTTCTT
hide sequence
RefSeq Acc Id:
XM_039112511 ⟹ XP_038968439
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 105,847,931 - 105,881,780 (+) NCBI mRatBN7.2 6 100,116,901 - 100,150,452 (+) NCBI
RefSeq Acc Id:
NP_001102185 ⟸ NM_001108715
- Sequence:
MSRQNLLALTVTTLLGVAMGGFVLWKGIQRKWSKTSRVMQPQLQPQPQQQQQPQPQQQQQPPQQEQQKQQVPGAREWPPPEDDQLPFGALRTPRASWEERILQAEVVTVSQEAEWNQIQPFLKRELED
hide sequence
RefSeq Acc Id:
XP_006240348 ⟸ XM_006240286
- Peptide Label:
isoform X1
- Sequence:
MSRQNLLALTVTTLLGVAMGGFVLWKGIQRKWSKTSRVMQPQLQPQPQQQQQPQPQQQQQPPQQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000030862 ⟸ ENSRNOT00000033378
RefSeq Acc Id:
XP_038968439 ⟸ XM_039112511
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000079247 ⟸ ENSRNOT00000094099
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-03-24
Exd2
exonuclease 3'-5' domain containing 2
Exdl2
exonuclease 3''-5'' domain-like 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Exdl2
exonuclease 3''-5'' domain-like 2
Exdl2_predicted
exonuclease 3''-5'' domain-like 2 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Exdl2_predicted
exonuclease 3''-5'' domain-like 2 (predicted)
RGD1311087_predicted
similar to expressed sequence C85658 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1311087_predicted
similar to expressed sequence C85658 (predicted)
LOC362759_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC362759_predicted
similar to expressed sequence C85658 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
