Symbol:
Arhgap21
Name:
Rho GTPase activating protein 21
RGD ID:
1311028
Description:
Predicted to enable GTPase activator activity. Predicted to be involved in several processes, including establishment of Golgi localization; maintenance of Golgi location; and organelle transport along microtubule. Predicted to act upstream of or within regulation of endocytosis. Predicted to be located in several cellular components, including Golgi apparatus; actin cytoskeleton; and cell junction. Orthologous to human ARHGAP21 (Rho GTPase activating protein 21); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.
Type:
protein-coding
RefSeq Status:
INFERRED
Previously known as:
LOC307178; rho GTPase-activating protein 21
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 88,256,961 - 88,380,478 (-) NCBI GRCr8 mRatBN7.2 17 83,348,673 - 83,472,202 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 83,348,673 - 83,472,444 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 86,828,401 - 86,951,837 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 90,663,807 - 90,787,236 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 84,680,722 - 84,804,160 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 87,725,978 - 87,797,436 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 87,725,867 - 87,826,421 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 89,415,087 - 89,486,545 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 94,817,558 - 94,941,088 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 94,828,397 - 94,951,968 (-) NCBI Celera 17 82,609,823 - 82,732,937 (-) NCBI Celera Cytogenetic Map 17 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arhgap21 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ARHGAP21 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARHGAP21 mRNA CTD PMID:22079256 Arhgap21 Rat 1,2-dimethylhydrazine decreases expression ISO Arhgap21 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ARHGAP21 mRNA CTD PMID:22206623 Arhgap21 Rat 17beta-estradiol decreases expression ISO Arhgap21 (Mus musculus) 6480464 Estradiol results in decreased expression of ARHGAP21 mRNA CTD PMID:39298647 Arhgap21 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Arhgap21 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Arhgap21 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Arhgap21 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Arhgap21 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ARHGAP21 mRNA CTD PMID:19465110 Arhgap21 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARHGAP21 mRNA CTD PMID:33387578 Arhgap21 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Arhgap21 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARHGAP21 mRNA CTD PMID:26290441 Arhgap21 Rat 2-hydroxypropanoic acid increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ARHGAP21 mRNA CTD PMID:30851411 Arhgap21 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Arhgap21 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Arhgap21 Rat 4,4'-sulfonyldiphenol affects expression ISO Arhgap21 (Mus musculus) 6480464 bisphenol S affects the expression of ARHGAP21 mRNA CTD PMID:39298647 Arhgap21 Rat 4-hydroxyphenyl retinamide decreases expression ISO Arhgap21 (Mus musculus) 6480464 Fenretinide results in decreased expression of ARHGAP21 mRNA CTD PMID:28973697 Arhgap21 Rat acrolein multiple interactions ISO ARHGAP21 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of ARHGAP21 mRNA CTD PMID:32845096 Arhgap21 Rat antirheumatic drug increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of ARHGAP21 mRNA CTD PMID:24449571 Arhgap21 Rat aristolochic acid A decreases expression ISO ARHGAP21 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ARHGAP21 mRNA CTD PMID:33212167 Arhgap21 Rat arsane affects methylation ISO ARHGAP21 (Homo sapiens) 6480464 Arsenic affects the methylation of ARHGAP21 gene CTD PMID:25304211 Arhgap21 Rat arsenic atom affects methylation ISO ARHGAP21 (Homo sapiens) 6480464 Arsenic affects the methylation of ARHGAP21 gene CTD PMID:25304211 Arhgap21 Rat arsenite(3-) multiple interactions ISO ARHGAP21 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ARHGAP21 mRNA] CTD PMID:32406909 Arhgap21 Rat arsenous acid increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ARHGAP21 mRNA CTD PMID:20458559 Arhgap21 Rat benzo[a]pyrene increases mutagenesis ISO ARHGAP21 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of ARHGAP21 gene CTD PMID:25435355 Arhgap21 Rat benzo[a]pyrene decreases methylation ISO Arhgap21 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of ARHGAP21 intron CTD PMID:27901495 Arhgap21 Rat benzo[a]pyrene increases expression ISO Arhgap21 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ARHGAP21 mRNA CTD PMID:19770486 Arhgap21 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ARHGAP21 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Arhgap21 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO ARHGAP21 (Homo sapiens) 6480464 Mustard Gas results in increased phosphorylation of ARHGAP21 protein CTD PMID:19845377 Arhgap21 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Arhgap21 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ARHGAP21 mRNA CTD PMID:33754040 Arhgap21 Rat bisphenol A affects expression ISO ARHGAP21 (Homo sapiens) 6480464 bisphenol A affects the expression of ARHGAP21 mRNA CTD PMID:22574217 Arhgap21 Rat bisphenol A decreases methylation ISO ARHGAP21 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ARHGAP21 gene CTD PMID:31601247 Arhgap21 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARHGAP21 mRNA CTD PMID:25181051 more ... Arhgap21 Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of ARHGAP21 protein CTD PMID:28903499 Arhgap21 Rat butanal decreases expression ISO ARHGAP21 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ARHGAP21 mRNA CTD PMID:26079696 Arhgap21 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ARHGAP21 mRNA CTD PMID:33453195 Arhgap21 Rat caffeine affects phosphorylation ISO ARHGAP21 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ARHGAP21 protein CTD PMID:35688186 Arhgap21 Rat carbon nanotube decreases expression ISO Arhgap21 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Arhgap21 Rat CGP 52608 multiple interactions ISO ARHGAP21 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ARHGAP21 gene] CTD PMID:28238834 Arhgap21 Rat chloropicrin increases expression ISO ARHGAP21 (Homo sapiens) 6480464 chloropicrin results in increased expression of ARHGAP21 mRNA CTD PMID:26352163 Arhgap21 Rat copper(II) sulfate increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ARHGAP21 mRNA CTD PMID:19549813 Arhgap21 Rat coumarin affects phosphorylation ISO ARHGAP21 (Homo sapiens) 6480464 coumarin affects the phosphorylation of ARHGAP21 protein CTD PMID:35688186 Arhgap21 Rat cyclosporin A increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ARHGAP21 mRNA CTD PMID:20106945 and PMID:25562108 Arhgap21 Rat diarsenic trioxide increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ARHGAP21 mRNA CTD PMID:20458559 Arhgap21 Rat dibutyl phthalate increases expression ISO Arhgap21 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ARHGAP21 mRNA CTD PMID:21266533 Arhgap21 Rat dimethylarsinic acid increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Cacodylic Acid results in increased expression of ARHGAP21 mRNA CTD PMID:17720352 Arhgap21 Rat epoxiconazole decreases expression ISO Arhgap21 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ARHGAP21 mRNA CTD PMID:35436446 Arhgap21 Rat formaldehyde decreases expression ISO ARHGAP21 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of ARHGAP21 mRNA CTD PMID:20655997 Arhgap21 Rat FR900359 affects phosphorylation ISO ARHGAP21 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of ARHGAP21 protein CTD PMID:37730182 Arhgap21 Rat methidathion decreases expression ISO Arhgap21 (Mus musculus) 6480464 methidathion results in decreased expression of ARHGAP21 mRNA CTD PMID:34813904 Arhgap21 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ARHGAP21 gene CTD PMID:35440735 Arhgap21 Rat methylmercury chloride increases expression ISO ARHGAP21 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ARHGAP21 mRNA CTD PMID:28001369 Arhgap21 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of ARHGAP21 gene CTD PMID:33148267 Arhgap21 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ARHGAP21 mRNA CTD PMID:25729387 Arhgap21 Rat ozone multiple interactions ISO ARHGAP21 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased oxidation of ARHGAP21 mRNA CTD PMID:32845096 Arhgap21 Rat paracetamol affects expression ISO Arhgap21 (Mus musculus) 6480464 Acetaminophen affects the expression of ARHGAP21 mRNA CTD PMID:17562736 Arhgap21 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of ARHGAP21 gene CTD PMID:33148267 Arhgap21 Rat pirinixic acid multiple interactions ISO ARHGAP21 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of ARHGAP21 mRNA CTD PMID:19710929 Arhgap21 Rat potassium chromate decreases expression ISO ARHGAP21 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ARHGAP21 mRNA CTD PMID:22079256 Arhgap21 Rat potassium chromate multiple interactions ISO ARHGAP21 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARHGAP21 mRNA CTD PMID:22079256 Arhgap21 Rat quercetin decreases phosphorylation ISO ARHGAP21 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of ARHGAP21 protein CTD PMID:35688186 Arhgap21 Rat rac-lactic acid increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ARHGAP21 mRNA CTD PMID:30851411 Arhgap21 Rat serpentine asbestos increases methylation ISO ARHGAP21 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased methylation of ARHGAP21 5' UTR CTD PMID:29523930 Arhgap21 Rat sunitinib increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Sunitinib results in increased expression of ARHGAP21 mRNA CTD PMID:31533062 Arhgap21 Rat temozolomide decreases expression ISO ARHGAP21 (Homo sapiens) 6480464 Temozolomide results in decreased expression of ARHGAP21 mRNA CTD PMID:31758290 Arhgap21 Rat thiram increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Thiram results in increased expression of ARHGAP21 mRNA CTD PMID:38568856 Arhgap21 Rat titanium dioxide decreases methylation ISO Arhgap21 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ARHGAP21 promoter alternative form CTD PMID:35295148 Arhgap21 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ARHGAP21 mRNA CTD PMID:25729387 Arhgap21 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ARHGAP21 mRNA CTD PMID:25729387 Arhgap21 Rat triphenyl phosphate affects expression ISO ARHGAP21 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ARHGAP21 mRNA CTD PMID:37042841 Arhgap21 Rat urethane increases expression ISO ARHGAP21 (Homo sapiens) 6480464 Urethane results in increased expression of ARHGAP21 mRNA CTD PMID:28818685 Arhgap21 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of ARHGAP21 mRNA CTD PMID:29427782 Arhgap21 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of ARHGAP21 gene CTD PMID:31079544
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrolein (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Brodifacoum (EXP) butanal (ISO) cadmium dichloride (EXP) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dimethylarsinic acid (ISO) epoxiconazole (ISO) formaldehyde (ISO) FR900359 (ISO) methidathion (ISO) methoxychlor (EXP) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) permethrin (EXP) pirinixic acid (ISO) potassium chromate (ISO) quercetin (ISO) rac-lactic acid (ISO) serpentine asbestos (ISO) sunitinib (ISO) temozolomide (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) urethane (ISO) valproic acid (EXP) vinclozolin (EXP)
Arhgap21 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 88,256,961 - 88,380,478 (-) NCBI GRCr8 mRatBN7.2 17 83,348,673 - 83,472,202 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 83,348,673 - 83,472,444 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 86,828,401 - 86,951,837 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 90,663,807 - 90,787,236 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 84,680,722 - 84,804,160 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 87,725,978 - 87,797,436 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 87,725,867 - 87,826,421 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 89,415,087 - 89,486,545 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 94,817,558 - 94,941,088 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 94,828,397 - 94,951,968 (-) NCBI Celera 17 82,609,823 - 82,732,937 (-) NCBI Celera Cytogenetic Map 17 q12.3 NCBI
ARHGAP21 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 24,583,614 - 24,723,887 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 24,583,609 - 24,723,887 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 24,872,543 - 25,012,816 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 24,912,549 - 25,052,550 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 24,912,550 - 25,052,550 NCBI Celera 10 24,564,446 - 24,712,895 (-) NCBI Celera Cytogenetic Map 10 p12.1 NCBI HuRef 10 24,534,090 - 24,673,492 (-) NCBI HuRef CHM1_1 10 24,872,464 - 25,013,653 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 24,602,382 - 24,742,515 (-) NCBI T2T-CHM13v2.0
Arhgap21 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 20,852,746 - 20,973,761 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 20,852,730 - 20,973,692 (-) Ensembl GRCm39 Ensembl GRCm38 2 20,847,919 - 20,968,691 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 20,847,919 - 20,968,881 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 20,769,546 - 20,889,348 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 20,765,673 - 20,886,635 (-) NCBI MGSCv36 mm8 Celera 2 20,722,855 - 20,850,910 (-) NCBI Celera Cytogenetic Map 2 A3 NCBI cM Map 2 14.6 NCBI
Arhgap21 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955429 4,424,425 - 4,559,596 (+) NCBI ChiLan1.0 ChiLan1.0
ARHGAP21 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 37,285,685 - 37,420,926 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 37,291,011 - 37,428,169 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 24,761,427 - 24,898,572 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 25,131,262 - 25,267,188 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 25,132,054 - 25,266,378 (-) Ensembl panpan1.1 panPan2
ARHGAP21 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 8,740,760 - 8,877,399 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 8,740,119 - 8,877,016 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 7,492,699 - 7,570,795 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 6,941,316 - 7,076,212 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 6,941,307 - 7,075,970 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 6,367,333 - 6,445,123 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 6,386,800 - 6,529,731 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 6,612,602 - 6,694,835 (+) NCBI UU_Cfam_GSD_1.0
Arhgap21
ARHGAP21 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 50,541,845 - 50,680,153 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 50,541,582 - 50,680,156 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 55,994,406 - 56,132,994 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARHGAP21 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 24,325,648 - 24,459,006 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 24,326,454 - 24,406,743 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666051 30,261,895 - 30,397,345 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arhgap21
.
Predicted Target Of
Count of predictions: 496 Count of miRNA genes: 265 Interacting mature miRNAs: 308 Transcripts: ENSRNOT00000068156 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
8694181 Bw151 Body weight QTL 151 4.36 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 1358295 Aocep1 Aortic cell protein QTL 1 6.1 7e-07 thoracic aorta cellular protein amount (VT:0010598) aortic cell percentage 17 40990005 85990005 Rat 7411575 Bw140 Body weight QTL 140 30.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 2317045 Aia11 Adjuvant induced arthritis QTL 11 4.06 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 60781426 86533673 Rat 7411577 Bw141 Body weight QTL 141 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 62619516 86533673 Rat 4889894 Eae33 Experimental allergic encephalomyelitis QTL 33 5.2 0.0001 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 50909099 86022412 Rat 2317038 Ginf3 Gastrointestinal inflammation QTL 3 2.89 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 17 49920154 86533673 Rat 2303580 Gluco49 Glucose level QTL 49 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 50040271 86533673 Rat
D17Got104
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 83,401,813 - 83,402,021 (+) MAPPER mRatBN7.2 mRatBN7.2 17 83,401,813 - 83,402,199 (+) MAPPER mRatBN7.2 Rnor_6.0 17 87,778,558 - 87,779,021 NCBI Rnor6.0 Rnor_6.0 17 87,778,558 - 87,778,765 NCBI Rnor6.0 Rnor_5.0 17 89,467,667 - 89,467,874 UniSTS Rnor5.0 Rnor_5.0 17 89,467,667 - 89,468,130 UniSTS Rnor5.0 RGSC_v3.4 17 94,870,697 - 94,870,904 UniSTS RGSC3.4 RGSC_v3.4 17 94,870,696 - 94,870,904 RGD RGSC3.4 RGSC_v3.1 17 94,881,530 - 94,881,737 RGD Celera 17 82,662,922 - 82,663,129 UniSTS RH 3.4 Map 17 872.1 UniSTS RH 3.4 Map 17 872.1 RGD RH 2.0 Map 17 725.2 RGD Cytogenetic Map 17 q12.3 UniSTS
RH144578
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 83,466,473 - 83,466,687 (+) MAPPER mRatBN7.2 Rnor_6.0 17 87,843,978 - 87,844,191 NCBI Rnor6.0 Rnor_5.0 17 89,533,087 - 89,533,300 UniSTS Rnor5.0 RGSC_v3.4 17 94,935,360 - 94,935,573 UniSTS RGSC3.4 Celera 17 82,727,257 - 82,727,470 UniSTS Cytogenetic Map 17 q12.3 UniSTS
RH134054
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 73,396,949 - 73,397,159 (+) MAPPER mRatBN7.2 mRatBN7.2 17 83,348,778 - 83,348,988 (-) MAPPER mRatBN7.2 mRatBN7.2 1 73,396,949 - 73,397,159 (-) MAPPER mRatBN7.2 mRatBN7.2 17 83,348,778 - 83,348,988 (+) MAPPER mRatBN7.2 Rnor_6.0 17 87,726,084 - 87,726,293 NCBI Rnor6.0 Rnor_6.0 1 65,806,400 - 65,806,609 NCBI Rnor6.0 Rnor_5.0 1 66,617,538 - 66,617,747 UniSTS Rnor5.0 Rnor_5.0 17 89,415,193 - 89,415,402 UniSTS Rnor5.0 RGSC_v3.4 1 72,686,261 - 72,686,470 UniSTS RGSC3.4 RGSC_v3.4 17 94,817,664 - 94,817,873 UniSTS RGSC3.4 Celera 17 82,609,929 - 82,610,138 UniSTS Celera 1 60,434,515 - 60,434,724 UniSTS RH 3.4 Map 17 833.7 UniSTS Cytogenetic Map 17 q12.3 UniSTS Cytogenetic Map 1 q21 UniSTS
RH142975
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 83,458,908 - 83,459,178 (+) MAPPER mRatBN7.2 Rnor_6.0 17 87,836,412 - 87,836,681 NCBI Rnor6.0 Rnor_5.0 17 89,525,521 - 89,525,790 UniSTS Rnor5.0 RGSC_v3.4 17 94,927,794 - 94,928,063 UniSTS RGSC3.4 Celera 17 82,719,691 - 82,719,960 UniSTS RH 3.4 Map 17 874.61 UniSTS Cytogenetic Map 17 q12.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068156 ⟹ ENSRNOP00000060787
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 83,348,673 - 83,448,927 (-) Ensembl Rnor_6.0 Ensembl 17 87,725,867 - 87,826,421 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096893 ⟹ ENSRNOP00000078699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 83,348,819 - 83,472,444 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110900 ⟹ ENSRNOP00000085743
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 83,348,819 - 83,472,444 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118116 ⟹ ENSRNOP00000097241
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 83,349,454 - 83,448,927 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118737 ⟹ ENSRNOP00000093003
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 83,348,819 - 83,472,444 (-) Ensembl
RefSeq Acc Id:
NM_001191693 ⟹ NP_001178622
RefSeq Status:
INFERRED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 88,256,961 - 88,380,478 (-) NCBI mRatBN7.2 17 83,348,673 - 83,472,202 (-) NCBI Rnor_6.0 17 87,725,978 - 87,797,436 (-) NCBI Rnor_5.0 17 89,415,087 - 89,486,545 (-) NCBI Celera 17 82,609,823 - 82,732,937 (-) NCBI
Sequence:
ATGATGGCCACACATTGGACTGGTCTGCCTGAGGGAGATGGTGACAAACTCAAGGCCTGTGGAGCCGCCTGTGAGGTGTCAAAAAATAAAGATGGAAAGGAACAGGGTGAACCCGTGTCACCGTCCGA
hide sequence
RefSeq Acc Id:
NP_001178622 ⟸ NM_001191693
- UniProtKB:
A0A8I5ZNY8 (UniProtKB/TrEMBL), A0A8I6AIU0 (UniProtKB/TrEMBL)
- Sequence:
MMATHWTGLPEGDGDKLKACGAACEVSKNKDGKEQGEPVSPSEDESFSWPGPKTVMLKRTSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTGDRI
hide sequence
Ensembl Acc Id:
ENSRNOP00000060787 ⟸ ENSRNOT00000068156
Ensembl Acc Id:
ENSRNOP00000093003 ⟸ ENSRNOT00000118737
Ensembl Acc Id:
ENSRNOP00000085743 ⟸ ENSRNOT00000110900
Ensembl Acc Id:
ENSRNOP00000078699 ⟸ ENSRNOT00000096893
Ensembl Acc Id:
ENSRNOP00000097241 ⟸ ENSRNOT00000118116
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Arhgap21
Rho GTPase activating protein 21
Arhgap21_predicted
Rho GTPase activating protein 21 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Arhgap21_predicted
Rho GTPase activating protein 21 (predicted)
Symbol and Name status set to approved
70820 APPROVED
