Golt1b (golgi transport 1B) - Rat Genome Database

Name: Golt1b
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Golt1b (golgi transport 1B) Rattus norvegicus

Analyze

Symbol:

Golt1b

Name:

golgi transport 1B

RGD ID:

1310691

Description:

Predicted to be involved in positive regulation of I-kappaB kinase/NF-kappaB signaling. Predicted to be located in Golgi membrane and cytosol. Predicted to be part of protein-containing complex. Predicted to be active in endoplasmic reticulum and membrane. Orthologous to human GOLT1B (golgi transport 1B); INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

golgi transport 1 homolog B; golgi transport 1 homolog B (S. cerevisiae); LOC362460; RGD1310691; similar to CGI-141 protein, EST AA407874; vesicle transport protein GOT1B

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GOLT1B (golgi transport 1B)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Golt1b (golgi transport 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Golt1b (golgi transport 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GOLT1B (golgi transport 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GOLT1B (golgi transport 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Golt1b (golgi transport 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GOLT1B (golgi transport 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GOLT1B (golgi transport 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GOLT1A (golgi transport 1A)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	GOLT1B (golgi transport 1B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Golt1b (golgi transport 1B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	golt1ba (golgi transport 1Ba)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	golt1bb (golgi transport 1Bb)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GOT1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32576	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	eas-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	175,333,056 - 175,346,156 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	175,333,092 - 175,346,153 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	181,627,959 - 181,639,174 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	177,412,228 - 177,423,443 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	176,032,787 - 176,044,002 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	176,606,669 - 176,617,884 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	176,606,649 - 176,619,710 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	240,820,407 - 240,831,669 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	179,952,033 - 179,963,246 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	180,197,146 - 180,210,095 (+)	NCBI
Celera	4	163,865,820 - 163,876,845 (+)	NCBI		Celera
Cytogenetic Map	4	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

dilated cardiomyopathy 1O (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4-hydroxyphenyl retinamide (ISO)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

caffeine (ISO)

captan (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dicrotophos (ISO)

folic acid (ISO)

folpet (ISO)

formaldehyde (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead(0) (ISO)

lead(2+) (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

nickel atom (ISO)

nicotine (ISO)

ozone (ISO)

paracetamol (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium dichromate (ISO)

testosterone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trimellitic anhydride (ISO)

triptonide (ISO)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endoplasmic reticulum to Golgi vesicle-mediated transport (IEA)

positive regulation of I-kappaB kinase/NF-kappaB signaling (ISO)

retrograde transport, endosome to Golgi (IEA)

Cellular Component

cytosol (IEA)

endoplasmic reticulum (IBA,ISO)

endoplasmic reticulum (ISO)

Golgi membrane (IEA)

membrane (IBA)

protein-containing complex (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:12761501	PMID:19946888	PMID:28246125

Genomics

Comparative Map Data

Golt1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	175,333,056 - 175,346,156 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	175,333,092 - 175,346,153 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	181,627,959 - 181,639,174 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	177,412,228 - 177,423,443 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	176,032,787 - 176,044,002 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	176,606,669 - 176,617,884 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	176,606,649 - 176,619,710 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	240,820,407 - 240,831,669 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	179,952,033 - 179,963,246 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	180,197,146 - 180,210,095 (+)	NCBI
Celera	4	163,865,820 - 163,876,845 (+)	NCBI		Celera
Cytogenetic Map	4	q44	NCBI

GOLT1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	21,501,789 - 21,518,408 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	12	21,501,781 - 21,518,408 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	21,654,723 - 21,671,342 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	21,546,067 - 21,562,357 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	21,546,066 - 21,562,357	NCBI
Celera	12	26,810,081 - 26,826,721 (+)	NCBI		Celera
Cytogenetic Map	12	p12.1	NCBI
HuRef	12	21,428,737 - 21,445,332 (+)	NCBI		HuRef
CHM1_1	12	21,620,299 - 21,636,937 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	21,380,798 - 21,397,367 (+)	NCBI		T2T-CHM13v2.0

Golt1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	142,332,929 - 142,349,584 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	142,332,947 - 142,349,584 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	142,387,211 - 142,413,835 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	142,387,221 - 142,403,858 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	142,335,763 - 142,352,378 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	142,344,465 - 142,361,080 (+)	NCBI		MGSCv36	mm8
Celera	6	145,447,191 - 145,464,316 (+)	NCBI		Celera
Cytogenetic Map	6	G2	NCBI

Golt1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	17,150,261 - 17,164,093 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	17,150,261 - 17,164,108 (+)	NCBI	ChiLan1.0	ChiLan1.0

GOLT1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	12	67,383,798 - 67,400,189 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	67,383,798 - 67,400,189 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	12	64,779,889 - 64,796,264 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

GOLT1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	25,576,724 - 25,590,241 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	25,578,788 - 25,590,258 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	20,761,612 - 20,775,117 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	25,805,162 - 25,818,872 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	25,792,502 - 25,818,889 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	25,598,054 - 25,611,760 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	25,621,269 - 25,634,773 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	20,937,759 - 20,951,496 (+)	NCBI		UU_Cfam_GSD_1.0

Golt1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	87,412,196 - 87,421,773 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936548	5,334,192 - 5,344,677 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936548	5,337,051 - 5,345,183 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GOLT1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	51,939,485 - 51,953,315 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	51,939,480 - 51,953,314 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	55,215,653 - 55,229,469 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GOLT1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	21,367,122 - 21,383,421 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	21,367,162 - 21,383,643 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666069	13,761,367 - 13,777,666 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Golt1b
220 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	355
Count of miRNA genes:	216
Interacting mature miRNAs:	249
Transcripts:	ENSRNOT00000016937
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	155561574	182687754	Rat
1300109	Rf13	Renal function QTL 13	3.91		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	4	157710145	182687754	Rat

Markers in Region

AA818489

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	175,345,854 - 175,346,067 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	176,619,408 - 176,619,620	NCBI	Rnor6.0
Rnor_5.0	4	240,833,193 - 240,833,405	UniSTS	Rnor5.0
RGSC_v3.4	4	179,964,770 - 179,964,982	UniSTS	RGSC3.4
Celera	4	163,878,369 - 163,878,581	UniSTS
RH 3.4 Map	4	1046.1	UniSTS
Cytogenetic Map	4	q44	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	37	34	18	19	18	7	9	74	33	38	11	7
Low		6	23	23		23	1	2		2	3		1
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001113783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC134270	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000084700 ⟹ ENSRNOP00000070214

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	175,333,120 - 175,346,153 (+)	Ensembl
Rnor_6.0 Ensembl	4	176,606,649 - 176,619,710 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108416 ⟹ ENSRNOP00000092199

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	175,333,100 - 175,345,312 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113495 ⟹ ENSRNOP00000079285

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	175,333,092 - 175,342,186 (+)	Ensembl

RefSeq Acc Id:

NM_001113783 ⟹ NP_001107255

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	175,333,115 - 175,344,331 (+)	NCBI
Rnor_6.0	4	176,606,669 - 176,617,884 (+)	NCBI
Rnor_5.0	4	240,820,407 - 240,831,669 (+)	NCBI
RGSC_v3.4	4	179,952,033 - 179,963,246 (+)	RGD
Celera	4	163,865,820 - 163,876,845 (+)	RGD

Sequence:

show sequence

CGGGTAGCGTCGCCGAGGCTCTTCTCTGGACTAGGCTTCGCAGCGTGGGCCCCGAGGCACCGCG
GTTCTCGCCGCCGCCGCCGCCATGATCTCCCTCACGGATACCCAGAAAATTGGCATGGGCTTAA
CAGGATTTGGAGTGTTTTTCCTGTTCTTTGGAATGATTCTCTTTTTTGACAAAGCACTGCTGGC
GATTGGAAATGTTCTGTTTGTGGCTGGTTTGGCTTTTGTAATTGGTCTAGAAAGAACATTCAGA
TTCTTCTTCCAGAAGCACAAAGTGAAAGCCACTGGATTTTTCCTGGGTGGTGTGTTCGTGGTCC
TTATTGGTTGGCCTTTGATAGGCATGATCTTCGAAATTTACGGATTCTTTCTCTTGTTCAGGGG
CTTTTTCCCAGTGGTGGTTGGCTTTATCAGAAGAGTGCCTGTCCTTGGATCCCTCCTGAATCTC
CCTGGAATCAGATCATTCGTAGACAAGGTCGGAGAAAGCAACAATATGGTATAACAACGAGGGA
ACTGAAGAATTTAAATACTGTATTATTTATAAAACCCTTTTGAAGAATATTCAGCACAAAGTTA
AATTTCACGAACTAGCGTATAAAGTTCCTTACAGAAGTTTAAAACGTACGCCCTCCAAAGTCCC
GACAGCTGTGGCAGAAGCGGCAGCAGGCTCATGAGGTCGGAGACCTGAACGAAGATGGAGAGGG
CGCGGCCTATTGCAACGCTTAGTGACGTCAGACGGCTGTCTCTTAGTCTTGCTGCAACGTGTGA
GACGGTCGTTCGTAGACAACATGGTGTCTGTTACTGTTTTTTAGAAGATTCAGGAACACCACTA
GGCATTTGATTTTTTTTTTTTTTATGATGTCCATTGTGATGGCCCAGATCTATCTAGGTGTGCT
GGGTTTCTAATGATGCCTGGATTGGATTGGATTATGTCGTCTCCATGTATCAGCCCAAGGAAGC
CCAGTTTCATGTGTGAATCACTTTTTTTGTAAACATGGATAAAATAAAACTTTTGTGGTCCTTT
TGAATCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039107914 ⟹ XP_038963842

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	175,333,066 - 175,346,156 (+)	NCBI

RefSeq Acc Id:

XM_039107915 ⟹ XP_038963843

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	175,333,056 - 175,346,156 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001107255	(Get FASTA)	NCBI Sequence Viewer
	XP_038963842	(Get FASTA)	NCBI Sequence Viewer
	XP_038963843	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58752	(Get FASTA)	NCBI Sequence Viewer
	EDM01499	(Get FASTA)	NCBI Sequence Viewer
	EDM01500	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001107255 ⟸ NM_001113783
- UniProtKB:	B0BNB0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHK VKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFV DKVGESNNMV hide sequence

RefSeq Acc Id:

ENSRNOP00000070214 ⟸ ENSRNOT00000084700

RefSeq Acc Id:	XP_038963843 ⟸ XM_039107915
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038963842 ⟸ XM_039107914
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000079285 ⟸ ENSRNOT00000113495

RefSeq Acc Id:

ENSRNOP00000092199 ⟸ ENSRNOT00000108416

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BNB0-F1-model_v2	AlphaFold	B0BNB0	1-138	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693487

Promoter ID:

EPDNEW_R4011

Type:

initiation region

Name:

Golt1b_1

Description:

golgi transport 1B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	176,606,650 - 176,606,710	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310691	AgrOrtholog
BioCyc Gene	G2FUF-42494	BioCyc
Ensembl Genes	ENSRNOG00000058386	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000070214.2	UniProtKB/TrEMBL
	ENSRNOP00000079285	ENTREZGENE
	ENSRNOP00000079285.1	UniProtKB/TrEMBL
	ENSRNOP00000092199	ENTREZGENE
	ENSRNOP00000092199.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000084700.2	UniProtKB/TrEMBL
	ENSRNOT00000108416	ENTREZGENE
	ENSRNOT00000108416.1	UniProtKB/TrEMBL
	ENSRNOT00000113495	ENTREZGENE
	ENSRNOT00000113495.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9102153	IMAGE-MGC_LOAD
InterPro	Got1	UniProtKB/TrEMBL
	Vesicle_transpt_Got1/SFT2	UniProtKB/TrEMBL
KEGG Report	rno:362460	UniProtKB/TrEMBL
MGC_CLONE	MGC:187933	IMAGE-MGC_LOAD
NCBI Gene	362460	ENTREZGENE
PANTHER	PTHR21493	UniProtKB/TrEMBL
	VESICLE TRANSPORT PROTEIN GOT1B	UniProtKB/TrEMBL
Pfam	Got1	UniProtKB/TrEMBL
PhenoGen	Golt1b	PhenoGen
UniProt	A0A0G2JXC0_RAT	UniProtKB/TrEMBL
	A0A8I5ZME6_RAT	UniProtKB/TrEMBL
	B0BNB0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Golt1b	golgi transport 1B	Golt1b	golgi transport 1 homolog B (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Golt1b	golgi transport 1 homolog B (S. cerevisiae)	Golt1b_predicted	golgi transport 1 homolog B (S. cerevisiae) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Golt1b_predicted	golgi transport 1 homolog B (S. cerevisiae) (predicted)	RGD1310691_predicted	similar to CGI-141 protein; EST AA407874 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1310691_predicted	similar to CGI-141 protein; EST AA407874 (predicted)	LOC362460_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362460_predicted	similar to CGI-141 protein; EST AA407874 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar