Advanced Search (OLGA)

Gene: Flywch1 (FLYWCH-type zinc finger 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Flywch1

Name:

FLYWCH-type zinc finger 1

RGD ID:

1309385

Description:

Predicted to enable transcription coactivator binding activity and transcription corepressor activity. Predicted to be involved in DNA damage response and negative regulation of transcription by RNA polymerase II. Predicted to be located in cytosol; nuclear body; and pericentric heterochromatin. Predicted to be part of transcription regulator complex. Orthologous to human FLYWCH1 (FLYWCH-type zinc finger 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amphetamine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

FLYWCH-type zinc finger-containing protein 1; LOC360488; RGD1309385; similar to RIKEN cDNA E030034P13

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FLYWCH1 (FLYWCH-type zinc finger 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Flywch1 (FLYWCH-type zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Flywch1 (FLYWCH-type zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FLYWCH1 (FLYWCH-type zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FLYWCH1 (FLYWCH-type zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Flywch1 (FLYWCH-type zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FLYWCH1 (FLYWCH-type zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FLYWCH1 (FLYWCH-type zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Flywch1 (FLYWCH-type zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC22A4 (solute carrier family 22 member 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FLYWCH1 (FLYWCH-type zinc finger 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Flywch1 (FLYWCH-type zinc finger 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	13,279,232 - 13,298,955 (-)	NCBI		GRCr8
mRatBN7.2	10	12,774,644 - 12,794,373 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	12,774,653 - 12,794,267 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	17,518,924 - 17,539,034 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	17,007,713 - 17,027,823 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	12,507,291 - 12,527,000 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	13,087,925 - 13,107,833 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	13,087,914 - 13,107,771 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	12,907,389 - 12,927,264 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	13,013,234 - 13,036,965 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	13,009,876 - 13,021,779 (-)	NCBI
Celera	10	12,469,943 - 12,489,573 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Flywch1	Rat	developmental and epileptic encephalopathy 1		ISO	FLYWCH1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 1	ClinVar	PMID:28492532
Flywch1	Rat	epilepsy		ISO	FLYWCH1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Epilepsy	ClinVar	PMID:28492532
Flywch1	Rat	Idiopathic Generalized Epilepsy		ISO	FLYWCH1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Idiopathic generalized epilepsy	ClinVar	PMID:28492532
Flywch1	Rat	short-rib thoracic dysplasia 9 with or without polydactyly		ISO	FLYWCH1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Saldino-Mainzer syndrome	ClinVar	PMID:28492532
Flywch1	Rat	Silver-Russell syndrome		ISO	FLYWCH1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Russell-Silver syndrome	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Flywch1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Flywch1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of FLYWCH1 mRNA	CTD	PMID:22206623
Flywch1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of FLYWCH1 mRNA	CTD	PMID:33387578
Flywch1	Rat	2-palmitoylglycerol	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of FLYWCH1 mRNA	CTD	PMID:37199045
Flywch1	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Flywch1 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of FLYWCH1 mRNA	CTD	PMID:26251327
Flywch1	Rat	3,4-methylenedioxymethamphetamine	increases methylation	ISO	Flywch1 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of FLYWCH1 promoter	CTD	PMID:26251327
Flywch1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Flywch1 (Mus musculus)	6480464	bisphenol S results in increased expression of FLYWCH1 mRNA	CTD	PMID:39298647
Flywch1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of FLYWCH1 mRNA	CTD	PMID:24780913
Flywch1	Rat	actinomycin D	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FLYWCH1 mRNA	CTD	PMID:38460933
Flywch1	Rat	aflatoxin B1	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of FLYWCH1 mRNA	CTD	PMID:22100608
Flywch1	Rat	amphetamine	decreases expression	EXP		6480464	Amphetamine results in decreased expression of FLYWCH1 mRNA	CTD	PMID:30779732
Flywch1	Rat	antirheumatic drug	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of FLYWCH1 mRNA	CTD	PMID:24449571
Flywch1	Rat	aristolochic acid A	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of FLYWCH1 mRNA	CTD	PMID:33212167
Flywch1	Rat	arsane	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FLYWCH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FLYWCH1 mRNA	CTD	PMID:39836092
Flywch1	Rat	arsenic atom	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FLYWCH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FLYWCH1 mRNA	CTD	PMID:39836092
Flywch1	Rat	arsenite(3-)	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	arsenite inhibits the reaction [G3BP1 protein binds to FLYWCH1 mRNA]	CTD	PMID:32406909
Flywch1	Rat	benzo[a]pyrene	increases methylation	ISO	FLYWCH1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of FLYWCH1 promoter	CTD	PMID:27901495
Flywch1	Rat	benzo[a]pyrene	affects methylation	ISO	FLYWCH1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of FLYWCH1 5' UTR	CTD	PMID:27901495
Flywch1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Flywch1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of FLYWCH1 mRNA	CTD	PMID:34319233
Flywch1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of FLYWCH1 mRNA	CTD	PMID:25181051
Flywch1	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of FLYWCH1 mRNA	CTD	PMID:33453195
Flywch1	Rat	cadmium dichloride	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of FLYWCH1 mRNA	CTD	PMID:38568856
Flywch1	Rat	caffeine	increases phosphorylation	ISO	FLYWCH1 (Homo sapiens)	6480464	Caffeine results in increased phosphorylation of FLYWCH1 protein	CTD	PMID:35688186
Flywch1	Rat	CGP 52608	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to FLYWCH1 gene]	CTD	PMID:28238834
Flywch1	Rat	chlorpyrifos	decreases expression	ISO	Flywch1 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of FLYWCH1 mRNA	CTD	PMID:37019170
Flywch1	Rat	cisplatin	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of FLYWCH1 mRNA	CTD	PMID:27392435
Flywch1	Rat	cobalt dichloride	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	cobaltous chloride results in increased expression of FLYWCH1 mRNA	CTD	PMID:19320972
Flywch1	Rat	cocaine	decreases expression	EXP		6480464	Cocaine results in decreased expression of FLYWCH1 mRNA	CTD	PMID:17898221
Flywch1	Rat	DDE	decreases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of FLYWCH1 mRNA	CTD	PMID:38568856
Flywch1	Rat	Dibutyl phosphate	affects expression	ISO	FLYWCH1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of FLYWCH1 mRNA	CTD	PMID:37042841
Flywch1	Rat	dibutyl phthalate	decreases expression	ISO	Flywch1 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of FLYWCH1 mRNA	CTD	PMID:21266533
Flywch1	Rat	epoxiconazole	decreases expression	ISO	Flywch1 (Mus musculus)	6480464	epoxiconazole results in decreased expression of FLYWCH1 mRNA	CTD	PMID:35436446
Flywch1	Rat	ethanol	affects splicing	ISO	Flywch1 (Mus musculus)	6480464	Ethanol affects the splicing of FLYWCH1 mRNA	CTD	PMID:30319688
Flywch1	Rat	ethyl methanesulfonate	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of FLYWCH1 mRNA	CTD	PMID:23649840
Flywch1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of FLYWCH1 mRNA	CTD	PMID:24136188
Flywch1	Rat	folic acid	decreases expression	ISO	Flywch1 (Mus musculus)	6480464	Folic Acid results in decreased expression of FLYWCH1 mRNA	CTD	PMID:25629700
Flywch1	Rat	FR900359	decreases phosphorylation	ISO	FLYWCH1 (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of FLYWCH1 protein	CTD	PMID:37730182
Flywch1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of FLYWCH1 mRNA	CTD	PMID:33387578
Flywch1	Rat	manganese atom	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FLYWCH1 mRNA	CTD	PMID:39836092
Flywch1	Rat	manganese(0)	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FLYWCH1 mRNA	CTD	PMID:39836092
Flywch1	Rat	manganese(II) chloride	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FLYWCH1 mRNA	CTD	PMID:39836092
Flywch1	Rat	methyl methanesulfonate	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of FLYWCH1 mRNA	CTD	PMID:23649840
Flywch1	Rat	N-nitrosodiethylamine	multiple interactions	ISO	Flywch1 (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of FLYWCH1 gene	CTD	PMID:23968726
Flywch1	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of FLYWCH1 mRNA	CTD	PMID:24136188
Flywch1	Rat	Nutlin-3	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FLYWCH1 mRNA	CTD	PMID:38460933
Flywch1	Rat	paracetamol	affects expression	ISO	Flywch1 (Mus musculus)	6480464	Acetaminophen affects the expression of FLYWCH1 mRNA	CTD	PMID:17562736
Flywch1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of FLYWCH1 mRNA	CTD	PMID:33387578
Flywch1	Rat	paracetamol	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of FLYWCH1 mRNA	CTD	PMID:22230336
Flywch1	Rat	pentachlorophenol	increases expression	ISO	Flywch1 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of FLYWCH1 mRNA	CTD	PMID:23892564
Flywch1	Rat	perfluorononanoic acid	decreases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of FLYWCH1 mRNA	CTD	PMID:38568856
Flywch1	Rat	piperonyl butoxide	multiple interactions	ISO	Flywch1 (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of FLYWCH1 gene	CTD	PMID:23968726
Flywch1	Rat	propanal	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	propionaldehyde results in increased expression of FLYWCH1 mRNA	CTD	PMID:26079696
Flywch1	Rat	resveratrol	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of FLYWCH1 mRNA	CTD	PMID:23557933
Flywch1	Rat	sodium arsenite	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of FLYWCH1 mRNA	CTD	PMID:38568856
Flywch1	Rat	sodium arsenite	multiple interactions	ISO	FLYWCH1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FLYWCH1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FLYWCH1 mRNA	CTD	PMID:39836092
Flywch1	Rat	sodium arsenite	decreases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of FLYWCH1 mRNA	CTD	PMID:34032870
Flywch1	Rat	thiram	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Thiram results in increased expression of FLYWCH1 mRNA	CTD	PMID:38568856
Flywch1	Rat	titanium dioxide	increases expression	ISO	Flywch1 (Mus musculus)	6480464	titanium dioxide results in increased expression of FLYWCH1 mRNA	CTD	PMID:29128614 and PMID:29264374
Flywch1	Rat	titanium dioxide	decreases methylation	ISO	FLYWCH1 (Homo sapiens)	6480464	titanium dioxide results in decreased methylation of FLYWCH1 promoter	CTD	PMID:34973136
Flywch1	Rat	titanium dioxide	decreases methylation	ISO	Flywch1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of FLYWCH1 gene and titanium dioxide results in decreased methylation of FLYWCH1 promoter	CTD	PMID:35295148
Flywch1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of FLYWCH1 mRNA	CTD	PMID:33387578
Flywch1	Rat	tungsten	decreases expression	ISO	Flywch1 (Mus musculus)	6480464	Tungsten results in decreased expression of FLYWCH1 mRNA	CTD	PMID:30912803
Flywch1	Rat	valproic acid	increases methylation	ISO	FLYWCH1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of FLYWCH1 gene	CTD	PMID:29154799
Flywch1	Rat	valproic acid	increases expression	ISO	FLYWCH1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of FLYWCH1 mRNA	CTD	PMID:28001369
Flywch1	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of FLYWCH1 mRNA	CTD	PMID:19015723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Flywch1	Rat	DNA damage response	involved_in	ISO	FLYWCH1 (Homo sapiens)	1624291	PMID:33924684	RGD	PMID:33924684
Flywch1	Rat	DNA damage response	involved_in	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Flywch1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	FLYWCH1 (Homo sapiens)	1624291	PMID:30097457	RGD	PMID:30097457
Flywch1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Flywch1	Rat	cytosol	located_in	ISO	FLYWCH1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Flywch1	Rat	cytosol	located_in	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Flywch1	Rat	nuclear body	located_in	ISO	FLYWCH1 (Homo sapiens)	1624291	PMID:33924684	RGD	PMID:33924684
Flywch1	Rat	nuclear body	located_in	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Flywch1	Rat	nuclear body	located_in	ISO	FLYWCH1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Flywch1	Rat	nucleoplasm	located_in	ISO	FLYWCH1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Flywch1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Flywch1	Rat	pericentric heterochromatin	located_in	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Flywch1	Rat	pericentric heterochromatin	located_in	ISO	FLYWCH1 (Homo sapiens)	1624291	PMID:34408139	RGD	PMID:34408139
Flywch1	Rat	transcription regulator complex	part_of	ISO	FLYWCH1 (Homo sapiens)	1624291	PMID:30097457	RGD	PMID:30097457
Flywch1	Rat	transcription regulator complex	part_of	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Flywch1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Flywch1	Rat	protein binding	enables	ISO	FLYWCH1 (Homo sapiens)	1624291	UniProtKB:A6NEM1 more ...	RGD	PMID:32296183
Flywch1	Rat	transcription coactivator binding	enables	ISO	FLYWCH1 (Homo sapiens)	1624291	UniProtKB:P35222 and PMID:30097457	RGD	PMID:30097457
Flywch1	Rat	transcription coactivator binding	enables	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Flywch1	Rat	transcription corepressor activity	enables	ISO	FLYWCH1 (Homo sapiens)	1624291	PMID:30097457	RGD	PMID:30097457
Flywch1	Rat	transcription corepressor activity	enables	IEA	UniProtKB:Q4VC44 and ensembl:ENSP00000253928	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Flywch1	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

Flywch1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	13,279,232 - 13,298,955 (-)	NCBI		GRCr8
mRatBN7.2	10	12,774,644 - 12,794,373 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	12,774,653 - 12,794,267 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	17,518,924 - 17,539,034 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	17,007,713 - 17,027,823 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	12,507,291 - 12,527,000 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	13,087,925 - 13,107,833 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	13,087,914 - 13,107,771 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	12,907,389 - 12,927,264 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	13,013,234 - 13,036,965 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	13,009,876 - 13,021,779 (-)	NCBI
Celera	10	12,469,943 - 12,489,573 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

FLYWCH1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	2,911,931 - 2,951,208 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	2,911,931 - 2,951,208 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	2,961,932 - 3,001,209 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	2,901,981 - 2,941,210 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	3,167,373 - 3,206,655 (+)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	2,933,879 - 2,973,694 (+)	NCBI		HuRef
CHM1_1	16	2,961,929 - 3,001,182 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	2,938,537 - 2,977,878 (+)	NCBI		T2T-CHM13v2.0

Flywch1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	23,971,767 - 23,993,504 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	23,971,767 - 23,990,576 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	23,752,795 - 23,774,530 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	23,752,793 - 23,771,602 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	23,892,390 - 23,908,558 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	23,483,045 - 23,491,398 (-)	NCBI		MGSCv36	mm8
Celera	17	24,249,349 - 24,265,342 (-)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	12.04	NCBI

Flywch1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	14,386,276 - 14,418,328 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	14,392,901 - 14,419,178 (-)	NCBI	ChiLan1.0	ChiLan1.0

FLYWCH1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	3,458,497 - 3,494,400 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	7,236,907 - 7,272,783 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	1,827,105 - 1,892,885 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	3,027,645 - 3,064,557 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	3,027,656 - 3,064,557 (+)	Ensembl	panpan1.1		panPan2

FLYWCH1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	38,223,341 - 38,246,991 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	38,224,825 - 38,244,866 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	39,463,838 - 39,487,336 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	38,533,925 - 38,571,052 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	38,533,934 - 38,557,430 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	38,219,679 - 38,243,168 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	38,192,197 - 38,229,284 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	38,667,982 - 38,691,473 (-)	NCBI		UU_Cfam_GSD_1.0

Flywch1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	105,472,907 - 105,496,946 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936694	1,215,774 - 1,236,606 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936694	1,212,517 - 1,236,576 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FLYWCH1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	39,225,365 - 39,242,675 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	39,223,885 - 39,244,743 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	40,660,183 - 40,680,188 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FLYWCH1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	2,654,583 - 2,689,184 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	2,670,081 - 2,690,582 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	28,145,121 - 28,220,247 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Flywch1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624824	680,554 - 695,025 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624824	659,892 - 695,997 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Flywch1
100 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	129
Count of miRNA genes:	75
Interacting mature miRNAs:	79
Transcripts:	ENSRNOT00000005879, ENSRNOT00000067269
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6154182	15990232	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat

RH136914

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	12,774,747 - 12,774,928 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	13,088,029 - 13,088,209	NCBI	Rnor6.0
Rnor_5.0	10	12,907,491 - 12,907,671	UniSTS	Rnor5.0
RGSC_v3.4	10	13,009,981 - 13,010,161	UniSTS	RGSC3.4
Celera	10	12,470,047 - 12,470,227	UniSTS
Cytogenetic Map	10	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001398792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_001056224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006220586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006220587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006245882	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006245883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017604001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017604002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269304	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC129118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005879 ⟹ ENSRNOP00000005879

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	12,774,653 - 12,794,267 (-)	Ensembl
Rnor_6.0 Ensembl	10	13,087,914 - 13,107,771 (-)	Ensembl

RefSeq Acc Id:

NM_001398792 ⟹ NP_001385721

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,232 - 13,298,925 (-)	NCBI
mRatBN7.2	10	12,774,644 - 12,794,338 (-)	NCBI

RefSeq Acc Id:

XM_006245882 ⟹ XP_006245944

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,298,954 (-)	NCBI
mRatBN7.2	10	12,774,644 - 12,794,373 (-)	NCBI
Rnor_6.0	10	13,087,925 - 13,107,833 (-)	NCBI
Rnor_5.0	10	12,907,389 - 12,927,264 (-)	NCBI

Sequence:

show sequence

TAGGCTTTCCAAGCCAGTGTCTCGCGGGGGCGCGCGCGCGCGCGCGGGCACGGGCTCGCTCCCCAGGGGGCAGTTGGCGGCGGGAGCGGGCGGCGGGGTCGTGGTTCTTAGAGCAGCACCGGCTGCTA
GGCCGGCGCCTCCATTAGCGGACATTTACACGAAGGACCGGGTGGCTCAGCCGCCGGAGAGGCAGGGCCCGCTGCCGTCGATAGGGCTTTTCTATGTAGCCCTGATCTGTGGGCCTTGGGTGGGCCTC
ACGATCACAGAGATCTTCCACCCCCTGCCTCCTGAGTGCCAGGATTAAAGGACCGAGGCTCTGAGTCTCACATTCTGGCCTAGGAGGAGGAAGAGGAGAGACCCATTTGCCAGAGGGCTGAAGGTGGC
CTTGAGGGCCATGCTCTCGGTCCCAGGATGCCCCTGCCTGAGCCCAGTGAGCAGGAGGGTGAGAGCCTGAGAGCTGGCCAGGAGCCATCCCGTGGAGCTCGGAAACCTCAAGAGTCCTCTAGTCTGGT
CCCGGCCAGGGACAAGGAGAAACCCAAGCCGACAGATGTCATGTCCCAGGAGACGTCCAGCACCACCACCCTACCTAACAACACCCTCCAGGCCTTGCCGGCCAAGAAGCAGGGACGGATAATTCACC
GGAAACGTAGTAGGGTAGATGCAGTTGCCCCCCAGCCCCTGGAGTTCCTGAAGACCCCATCTGGGAGCCGCCTTCTGGTGCACAAGTCGTTCCTTTACAAGCAGGAGAAGGCCGTGGGGGACAAGGTG
TACTGGAAATGCCGCCAGCACTCAGAGCTGGGCTGCCGGGGCCGGGCCATCACTCGTGGCTTTCGAGTCACAGAGATGCGGGACCATTGTCACCCACCTGAAAAGGAAGGCCTGGGAAAGAAAAGGCG
CCAGAAGGAAAAGCTGCCCAGCTCGGGCACTGAAGGCCAAGGAGATGGGGTGAGCTTGTGGCTGTACCCTGTGGAGCCGGAACCCACCCCTCAGCCAAGCATCGAAACCCCAGAGGAGGAGCAGGGGT
ACCGCTCCCTGGCACTGCAGAGCCTGCCTCCCAAGAAACGCCCCACCCCAGGAGTGGTACGGTATCGGCCTCTTGAGTTCCTGAAGACCTGCTACGGGGGGACCTTCCTGGTGCACCAGTCCTTCCTC
TACAAGCGGGAGAAGACAGTAGGAAGCAAGGTGTACTGGACCTGCCGGGAACATGCGGTCCATGGCTGCCGCAGCCGTGCCATCACCCAGGGCCAGCGCGTGACGGTGATGCGCAGCCACTGCCACTC
ACCTGACATGGAAGGCTTGCAGGCCCGGCGGCAGCAGGAGAAGACCATAAAGAAGATACAGGCAAGGCGGATTGGGGCTGGGGACCTGGAGGATTGTGATGACATTGAAGACACACTGCTGCAAGGGG
TGGACAGCCTGTTCTACCGCAGAGGGCCAGGCACACTGACTCTCAGTAGATCCAGGTCCAGGAAACGAGCAAAGAAGCAGCAGGAACCCTTGCAGGAATCCCCCGAGGAGGAGGACCAGGATGTGGAC
CCCAAAGGCCCAGAGTTCCTGAAGACCCCTCTGGGGGGCAACTTCCTGGTGTACGAGTCCTTCCTCTACAGACGGGAAAAAGTGGCCGGAGAGAAGGTGTACTGGACTTGCCGGGACCAGGCACGCAT
GGGCTGCCGCAGCCGGGCCATCACCCAGGGCAGGCAGGTGACTGTGATGCGAGGCCACTGTCACCCACCTGACCTGTTAGGATTGGAGACTCTGAGGCAGCGGCAGAAACGCCCAGGCCCTGCTCAGT
GGGATGGCCCAGAAGGGCCTGAGTTCCTGAAGACCCCTCTGGGGGGCAGCTTCCTGGTGTACGAGTCCTTCCTCTACAGGCGGGAGAAAGCGACCGGCGATAAGGTGTACTGGACTTGCCGGGACCAG
GCACGCATGGGTTGCCGCAGCCGCGCCATCACCCAGGGCCAGCGGGTGATGGTCATGCGCAGGCACTGCCACCCACCAGACATGGGTGGCCTGGAAGCCCTGCGGCAGAGGGAGAACTTCCCTAACCT
GACCCACTGGGAAGGCCCAGAGCCCGTGCAGCCGCTGGAGTTCCTGCAGACATCCCTTGGAGGCCGCTTCCTGGTGTACGAGTCCTTCCTGTACAGGAAGGAGAAGGCCGCCGGCGAGAAGGTGTACT
GGATGTGCCGGGACCAGGCTCGGCTGGGCTGCCGCAGCCGCGCCATTACCCAGGGCCGTCGGGTCATGGTGATGCGAAGCCACTGCCATTCCCCTGACCTGGCTGGCCTGGAGGCCCTGAGGCAGCGG
GAGAGGGAGAAGGCCCGGGAGAGGGAGAAGGCCCGGGAGAGGGAGAAGGCCCCCAGTGCAGCCAAGAAGAAAAAGAAGAAGAAGAAGAAGAAAGGAAAATCAAAGAGCTAAAACCGATCAGCCAGTCC
TGCTGCAGTATCTTCTCTGGAACAACAGAGGAGCAGCGGGCACCCCAGATGCTTCCCATCCACACAGGCGTTCCCATCCATTCAGATGCGCTTGGTGACAACTCTTTCCACTCTTCCAAACACCCAGG
ACCGTCACATTTCCTCAGAGGTCTCCCCGGAGGAGCGCTTGGACTTTGGGTGGTAACCAAGCCGGATGGGTGGCCTGCAGGCCTGCCCCATGCTGCTCTCACCGTGACCTGAGCTGTGGAGAAGTGTG
TGTGGACTGATAGACCTCTGCCCACTCTGCTGTCCAGGCCTCAGCACCATCTGCTTTCAGAGCATGCTGTCTGAGCTTTCCAGTGGGGTGTGACCCTGTGCGAGTGAGCATGAACTTCAGCAAAATGG
AAGTCATCCCAAGTCAGGATATGTACGGGGACTTCCTGCCACTCTCTGAAGACAGTGCAAGTCATAGCAGGGTTTTGTTTTGTTATCTTTTAGGGACAGGTGTGAGGCCTTCCTGGTCTTTTGTCACT
TGCTGCTTACTAAGGCACATCCAGCCCTGACCGTGGCAGAGCAGGCCAGGCTGAAGGCTTCGCTGTACCTTCCTGGCCGACTTTGCATCCTGTGTTCTTTGCTACCTTAAACCTATGTCCACAGTTCT
TGGGCGCCAGCCCAGAGGTCAGGAGGAGGTGACACCAGGTAGGCATGCTCTGGTGGCAGCAGCACCACCGAGAGTTGCCCACCTAGTGTCACATGATACACAAGGTCAGTAGGTGGCATCAAGCCCAC
CTCCTGTAGAAGAGGCTAGCAGGACTAAGGAGCCATGTTAGCAGTGGCATTCTAGTGTCCCTGGGAATGCAGAATCTCCTGTGTGCTGCCCCTGGCCAGAGCTGTCCTCACCCTGTCTCAGAGCTGCA
TGCTCCTCTCCCTTAGCAAGCAAGCCATGGAGCAGCCACCCCTGTGGGATAGTAATGGCCTGGTGCCTACCACTGGCTTCTGCTCATCTGCTTCCCTCAATAAACCCTATGTAGTCTCACGGTACAGA

hide sequence

RefSeq Acc Id:

XM_039087076 ⟹ XP_038943004

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,298,955 (-)	NCBI
mRatBN7.2	10	12,774,644 - 12,794,373 (-)	NCBI

RefSeq Acc Id:

XM_063269299 ⟹ XP_063125369

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,298,954 (-)	NCBI

RefSeq Acc Id:

XM_063269300 ⟹ XP_063125370

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,297,286 (-)	NCBI

RefSeq Acc Id:

XM_063269301 ⟹ XP_063125371

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,298,954 (-)	NCBI

RefSeq Acc Id:

XM_063269302 ⟹ XP_063125372

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,298,954 (-)	NCBI

RefSeq Acc Id:

XM_063269303 ⟹ XP_063125373

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,298,954 (-)	NCBI

RefSeq Acc Id:

XM_063269304 ⟹ XP_063125374

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,297,286 (-)	NCBI

RefSeq Acc Id:

XM_063269305 ⟹ XP_063125375

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	13,279,236 - 13,298,954 (-)	NCBI


Protein RefSeqs	NP_001385721	(Get FASTA)	NCBI Sequence Viewer
	XP_006245944	(Get FASTA)	NCBI Sequence Viewer
	XP_038943004	(Get FASTA)	NCBI Sequence Viewer
	XP_063125369	(Get FASTA)	NCBI Sequence Viewer
	XP_063125370	(Get FASTA)	NCBI Sequence Viewer
	XP_063125371	(Get FASTA)	NCBI Sequence Viewer
	XP_063125372	(Get FASTA)	NCBI Sequence Viewer
	XP_063125373	(Get FASTA)	NCBI Sequence Viewer
	XP_063125374	(Get FASTA)	NCBI Sequence Viewer
	XP_063125375	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI29119	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005879
	ENSRNOP00000005879.7

RefSeq Acc Id:	XP_006245944 ⟸ XM_006245882
- Peptide Label:	isoform X1
- UniProtKB:	F7FDF2 (UniProtKB/TrEMBL), A1L1L4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPLPEPSEQEGESLRAGQEPSRGARKPQESSSLVPARDKEKPKPTDVMSQETSSTTTLPNNTLQALPAKKQGRIIHRKRSRVDAVAPQPLEFLKTPSGSRLLVHKSFLYKQEKAVGDKVYWKCRQHSE LGCRGRAITRGFRVTEMRDHCHPPEKEGLGKKRRQKEKLPSSGTEGQGDGVSLWLYPVEPEPTPQPSIETPEEEQGYRSLALQSLPPKKRPTPGVVRYRPLEFLKTCYGGTFLVHQSFLYKREKTVGS KVYWTCREHAVHGCRSRAITQGQRVTVMRSHCHSPDMEGLQARRQQEKTIKKIQARRIGAGDLEDCDDIEDTLLQGVDSLFYRRGPGTLTLSRSRSRKRAKKQQEPLQESPEEEDQDVDPKGPEFLKT PLGGNFLVYESFLYRREKVAGEKVYWTCRDQARMGCRSRAITQGRQVTVMRGHCHPPDLLGLETLRQRQKRPGPAQWDGPEGPEFLKTPLGGSFLVYESFLYRREKATGDKVYWTCRDQARMGCRSRA ITQGQRVMVMRRHCHPPDMGGLEALRQRENFPNLTHWEGPEPVQPLEFLQTSLGGRFLVYESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGRRVMVMRSHCHSPDLAGLEALRQREREKARERE KAREREKAPSAAKKKKKKKKKKGKSKS hide sequence

Ensembl Acc Id:

ENSRNOP00000005879 ⟸ ENSRNOT00000005879

RefSeq Acc Id:	XP_038943004 ⟸ XM_039087076
- Peptide Label:	isoform X1
- UniProtKB:	F7FDF2 (UniProtKB/TrEMBL), A1L1L4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001385721 ⟸ NM_001398792
- UniProtKB:	F7FDF2 (UniProtKB/TrEMBL), A1L1L4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063125372 ⟸ XM_063269302
- Peptide Label:	isoform X1
- UniProtKB:	F7FDF2 (UniProtKB/TrEMBL), A1L1L4 (UniProtKB/TrEMBL)

Protein Domains

FLYWCH-type FLYWCH-type zinc finger-containing protein N-

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F7FDF2-F1-model_v2	AlphaFold	F7FDF2	1-667	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13697007

Promoter ID:

EPDNEW_R7521

Type:

initiation region

Name:

Flywch1_1

Description:

FLYWCH-type zinc finger 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	13,107,788 - 13,107,848	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-25906	BioCyc
Ensembl Genes	ENSRNOG00000004333	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005879	ENTREZGENE
	ENSRNOT00000005879.8	UniProtKB/TrEMBL
Gene3D-CATH	2.20.25.240	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7114597	IMAGE-MGC_LOAD
InterPro	FLYWCH_N	UniProtKB/TrEMBL
	FWCH1/FWCH2	UniProtKB/TrEMBL
	Znf_FLYWCH	UniProtKB/TrEMBL
MGC_CLONE	MGC:156766	IMAGE-MGC_LOAD
NCBI Gene	360488	ENTREZGENE
PANTHER	FLYWCH-TYPE ZINC FINGER-CONTAINING PROTEIN 1	UniProtKB/TrEMBL
	PTHR31665	UniProtKB/TrEMBL
Pfam	FLYWCH	UniProtKB/TrEMBL
	FLYWCH_N	UniProtKB/TrEMBL
	FLYWCH_u	UniProtKB/TrEMBL
PhenoGen	Flywch1	PhenoGen
RatGTEx	ENSRNOG00000004333	RatGTEx
UniProt	A1L1L4	ENTREZGENE, UniProtKB/TrEMBL
	F7FDF2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-26	Flywch1	FLYWCH-type zinc finger 1	RGD1309385_predicted	similar to RIKEN cDNA E030034P13 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1309385_predicted	similar to RIKEN cDNA E030034P13 (predicted)	LOC360488_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC360488_predicted	similar to RIKEN cDNA E030034P13 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar